m.tribunnews.com website review
Improve your SEO :: free trial!
Most important optimization pointers for m.tribunnews.com
This is a prioritized list for m.tribunnews.com of the issues, ordered ascending, and starting with the biggest quick wins for your website. The biggest quick win is the opportunity that requires the least effort to implement compared to the optimization payoff in effect.
Avoid the use of (i)frames
Improve the link descriptions
Improve the relevance of the headings
m.tribunnews.com is 54% geoptimaliseerd!
SEO Keyword summary for m.tribunnews.com
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be lalu
Focus keyword
Short and long tail
Short Tail Keywords lalu jam dan |
long Tail Keywords (2 words) jam lalu menit lalu jawa timur 4 jam kota negara |
long Tail Keywords (3 words) 4 jam lalu ibu kota negara rompi putra mulyono bisnis1 jam lalu nasional1 jam lalu pakai rompi putra pemindahan ibu kota |
m.tribunnews.com On-Page SEO Scan
Descriptive Elements
The <head> element of a m.tribunnews.com page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
tribunnewscom berita dan video terkini dari indonesia dengan sudut pandang lokal
Meta description
Meta description legth
Meta description SEO
tribunnewscom menyajikan berita dan video terkini dari regional nasional internasional dengan sudut pandang nilainilai lokal
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Nu emphasized (bold or italic) words detected !
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
aplikasi tribun lestari tribunnews jokowigroundbreakingdprimahotelikn jpg anggotadprfotobersamajelangpurnatugasjpg sidangmantangubernurmalukuutaraabdulghanikasubajpg gurutamparmuridjpg pupdateviralvideoasnlarangtetanggaibadahsebutberdoaharusadaizinberakhirmintamaafjpg kontainerlogistikjpg presidenjokowiusaimelakukangroundbreakingdelonixnusantara ilustrasitikammenikamtusukjpg ketuafraksipkbmprrijazilulfawaideqwdasjpg jokowiresmikangroundbreakingsekolahinternasionalikn kakondisitaksaka iriana jokowi pamit saya minta maaf kalau ada salah selama ini tanggal oktober sudah purnatugas psi tak tahu soal rompi putra mulyono yang dipakai kaesang tibatiba saat blusukan full adu kuat jenderal pilkada jateng pengamat simpati mengalir andika banteng dikeroyok polisi periksa fans hingga teman lolly hasil visum sementara anak nikita mirzani keluar kotabeirutlebanondenganpemandanganpantainyayangmemukaujpg tingkatantaxratiodirutbrisunarsoungkappentingnyamemformalkanumkmjpg sultanbachtiarnajamudinmengunjungipresidenterpilihprabowosubiantojpg ilustrasihamil pakai kala dan bagibagi susu tangerang mengapa komeng dipilih jadi calon wakil ketua mpr alasan para anggota dpd kronologis guru smp lamongan tampar siswanya korban panggil nama pelaku tanpa sapaan ibu ditanya begini reaksi groundbreaking sekolah internasional ikn mampu tampung siswa preschool sma sarwendah lagi dinafkahi usai cerai sepakat ruben onsu hanya biayai anakanaknya ketuamprribambangsoesatyoaliasbamsoetsaatmembukasidangakhirmprriperiode banner wawancarakhususmenkominfobudiariesetiadi presidenjokowiusaimelakukangroundbreakingdelonixnusantarajpg kabidhumaspoldametrojayakombespolisiadearysyamindradijpg shopping logo review parfum lokal myra varian wood sea wanginya elegan tahan jam manfaat menggunakan garam himalaya untuk kecantikan satunya bisa cegah penuaan dini rekomendasi serum pria perawatan kulit cerah bebas kusam euromedica group buka klinik skin slim clinic cara bakal bikin macbook kembali ngebut layaknya barang baru wajib dicoba mengusir bekicot sekitar rumah secara alami terutama musim hujan tiba gedungkkp iknke bekerjasamadenganshopeeyoutubemeluncurkanprogramyoutubeshoppingaffiliatesdiindonesiajpg prabowodangibranpilpres penemuanmayatbekasikjdjpg situsnipponsteel lebanon negara dikenal swissnya timur tengah itu kini diambang kehancuran akibat perang israel sikapi serangan brutal telepon menlu bahas pemulangan wni dari pbb puluhan ribu warga terpaksa tinggalkan senjata kiamat hizbullah kewalahan jika nekat analisis apakah iran membiarkan bertempur sendirian melawan rudal menjangkau meski jaraknya akan jerumuskan melelahkan seperti dilakukan hamas eks pejabat pesimis kalahkan sebut tel aviv kalah jauh segi kekuatan terjebak bawah reruntuhan bangunan hancur dibom orang tewas sekutu dekat netanyahu yordania target berikutnya setelah gaza bsi presidenaspekindonesiamirahsumiratjpg suasanasidangakhirmajajabatananggotamprriperiode xanthophobiafobiawarnakuningjpg ptpspengawastempatpemungutansuarajpg dbreakingmagnumrefjpg kataksakarelasistasiungambiryogyakartajpg bankmandiridukungproject mpactjpg shorts smailsalismailsalivvvjpg areapersawahan ketualmailwayabdukungpenuhprogramcetaksawahdantidakadapenyerobotantanahulayatjpg agusgumiwanggorishima parkiranstasiunbogorjpg keluargabachdimjpg jurubicarakpktessamahardhikasugiartotampiljpg jasaraharjapolribaksosjpg jasaraharjaberikansantunandanjaminbiayaperawatankorbankecelakaanbusdantrukdipatijpg juangdarikelompoksyiahlebanonhizbullahjpg federicochiesaresmidiperkenalkanliverpooljpg aumumpsikaesangpangarepmejpg arsenalmenangtelakatasbayerleverkusendistadionemiratesjpg dryuuchiyama jokowiprabowoiknnihhhhjpg tribunjualbeli dijual lantai nyaman jantung cimahi didekat pemkot toko kursi kantor surabaya dijamin aman ayunan besi bulat besar mainan playground garut mukena bordir tangan pasuruan software kasir fitur canggih mojokerto shm desain modern ringroad selatan kasihan bantul jogja polos premium tanah luas jalan kota pontianak travel umroh bagus jawa murah wonosari gunungkidul jasa konstruksi baja ringan minimalis gresik mangkok putar kerja bos malang outdoor mijen demak atap tinggal supplier pertama paulan colomadu solo adi sucipto surakarta terpecaya haji terbaik mulyorejo konsultan bisnis online bagi pemula sidoarjo kecelakaanhariinidibantultrukmolennekatmelintasakhirnyatertabrakkeretaapitaksakajpg nikitamirzaniungkapkondisilollysaatinivibesnyasudahbedajpg irjenkaryotokaryotodatangketkpditemukannyatujuhpriayangtewasmengapungjpg kapoldajatengirjenpolributhariwibowomenghindariulurantangandariandikaperkasajpg hoteldijakartadengantarifdibawah ribuanjpg ilustrasilokasilayanansimkelilingjpg muhammadrizki satudaritujuhmayatkalibekasjpg pelakuise kanandendamkarenapernahjadikorbanpenyiramanairkerasjpg
Mobile SEO m.tribunnews.com
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for m.tribunnews.com
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
The title is trucated
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
home
|
bisnis asosiasi dorong aturan wajib gunakan digitalisasi pembayaran di sektor logistik apa alasannya
kecelakaan kereta api vs truk di bantul pengamat pengawasan faktor eksternal perlu ditingkatkan
tingkatan tax ratio dirut bri sunarso ungkap pentingnya memformalkan umkm
kkp gandeng korea selatan perkuat sistem jaminan mutu produk perikanan
groundbreaking teras hutan ikn jokowi ini membeli suasana tak bisa didapatkan di tempat lain
volume transaksi qris dan atm bsi di aceh naik double digit selama pon xxi
aspirasi banyak lahan pertanian di ri kini jadi perumahan sampai lapangan golf
jokowi paparkan akses menuju ikn kepada para investor rusia
tabrakan ka taksaka dan truk molen kai masinis dan asitennya cidera perjalanan sudah normal lagi
poligonisasi perluasan areal tanam di sukabumi kini lahan tanam naik mendekati 100 persen
menperin agus gumiwang diberi gelar honorary doctorate dari hiroshima university
ka taksaka tabrak truk di perlintasan stasiun sentolorewulu yogyakarta begini kondisinya
hari ini presiden jokowi kembali groundbreaking proyek di ikn berikut daftarnya
|
internasional lebanon negara yang dikenal swissnya timur tengah itu kini diambang kehancuran akibat perang israel
nippon steel jepang jual semua sahamnya yang ada di perusahaan korea posco holdings
pbb puluhan ribu warga terpaksa tinggalkan lebanon di tengah serangan israel
senjata kiamat hizbullah bisa bikin israel kewalahan jika nekat perang
analisis apakah iran membiarkan hizbullah bertempur sendirian melawan israel
9 rudal iran yang bisa menjangkau israel meski jaraknya 1770 km
hizbullah akan jerumuskan israel ke perang melelahkan seperti yang dilakukan hamas
2 eks pejabat pesimis israel bisa kalahkan hizbullah sebut tel aviv kalah jauh dari segi kekuatan
warga lebanon terjebak di bawah reruntuhan bangunan yang hancur dibom israel 558 orang tewas
sekutu dekat netanyahu yordania bisa jadi target israel berikutnya setelah gaza dan lebanon
koizumi atau ishiba gantikan fumio kishida jadi pm jepang ini analisis profesor universitas tokyo
|
kilas-kementerian jazilul fawaid keamanan komprehensif menjadi kunci mewujudkan stabilitas politik dan keamanan
ketua lma ilwayab dukung penuh program cetak sawah dan tidak ada penyerobotan tanah ulayat
|
lifestyle cara jennifer dan irfan bachdim lindungi keluarga di rumah basmi nyamuk dan serangga sampai tuntas
|
m.tribunnews.com mata lokal memilih
regional
mata lokal
bisnis
super skor
sport
musik
seleb
lifestyle
travel
parapuan
otomotif
techno
kesehatan
tribunners
video
kilas kementerian
images
indeks tag
indeks
tribun network
about us
redaksi
info iklan
contact us
terms of use
privacy policy
pedoman media siber
valsubtitle
valtitlevtitle
valstitle
metropolitan
nasional
internasional
new economy
|
mata-lokal-memilih hari pertama kampanye pilkada 2024 jokowi minta calon kepala daerah semangat sampaikan visi misi
mengapa komeng yang dipilih jadi calon wakil ketua mpr ini
|
metropolitan tak terima diminta cerai seorang suami di bekasi tikam istrinya
odgj penghuni panti sosial di jakbar melahirkan seorang lainnya hamil pihak panti beri penjelasan
ditanya alasan pakai rompi putra mulyono saat blusukan di
didampingi pendeta ini pernyataan lengkap permintaan maaf asn bekasi yang larang ibadah di rumah
polri jalankan misi kemanusiaan dalam kasus kematian tujuh remaja di kali bekasi
jaga kredibilitas di mata konsumen bapenda ingatkan pengusaha parkir bayar pajak
|
nasional jokowi akui tak mudah membangun ibu kota negara salah satu tantangannya memindahkan asn
jelang purna tugas para anggota dewan
panggilan kpk dikira penipuan jadi alasan
investor cina bangun hotel hingga pusat perbelanjaan senilai rp 500 miliar di ikn
kandidat ketua dpd ri sultan najamudin temui prabowo la nyalla siap lengser
saat kaesang pakai rompi putra mulyono kala blusukan dan bagibagi
jokowi groundbreaking sekolah internasional di ikn mampu tampung
buka sidang akhir masa jabatan mpr bamsoet lontarkan pantun singgung pohon beringin diterjang badai
menkominfo transformasi menuju kedaulatan digital harus melalui penguatan sdm dan regulasi
sikapi serangan brutal israel jokowi telepon menlu bahas pemulangan wni dari lebanon
jumlah menteri bertambah jumlah komisi di dpr ikut membengkak bagibagi kekuasaan
kpai dalami dugaan penggunaan senjata oleh polisi dalam kasus tewasnya 7 remaja di kali bekasi
mpr ri gelar sidang akhir masa jabatan 20192024 sempat diskors karena belum kuorum
jelang purna tugas para anggota dewan berswafoto di sidang akhir mpr ri periode 20192024
jokowi akui tak mudah membangun ibu kota negara salah satu tantangannya memindahkan asn
panggilan kpk dikira penipuan jadi alasan 14 saksi terkait kasus korupsi eks gubernur malut mangkir
kasus korupsi di pgn kpk telusuri perjanjian jual beli gas dan akuisisi pt iae
rayakan hut ke69 lalu lintas bhayangkara korlantas polri dan jasa raharja gelar baksos di kuningan
jasa raharja berikan santunan dan jamin biaya perawatan korban kecelakaan bus dan truk di pati
saat kaesang pakai rompi putra mulyono kala blusukan dan bagibagi susu di tangerang
|
new-economy youtube shopping bermitra dengan shopee di indonesia jadi peluang cuan baru untuk kreator
|
parapuan lewat program project 1mpact bank mandiri dukung perempuan indonesia jadi penggerak ekonomi
|
regional kronologis guru smp di lamongan tampar
update viral asn bekasi larang tetangga
kronologis guru smp di lamongan tampar siswanya korban panggil
kronologis guru smp di lamongan tampar siswanya korban panggil nama ke pelaku tanpa sapaan ibu
|
seleb sarwendah tak lagi dinafkahi usai cerai sepakat ruben onsu
|
superskor saatnya federico chiesa unjuk gigi debut di anfield jelang laga liverpool vs west ham
the gunners bertemu musuh lama saat arsenal melawan bolton di efl cup kamis 26 sep pukul 0145 wib
|
tag function countdowntargetdate elementid const targettime new datetargetdategettime const timer setinterval const now new dategettime const distance targettime now if distance 0 clearintervaltimer documentgetelementbyidelementidinnertext 0 else const days mathfloordistance 1000 60 60 24 documentgetelementbyidelementidinnertext days 20 countdownnov 27 2024 countdownpilkada
pasar mobil
amerika serikat
asosiasi dealer mobil china cada
komeng
wakil ketua mpr
senator
akbar supratman
uni eropa
minyak rusia
tito karnavian
tenaga honorer
pemilihan kepala daerah
abdullah azwar anas
unesco
odessa
monumen
munaslub kadin
kadin indonesia
ahmad irfansyah
pertanian
|
topic pilkada serentak 2024
pemindahan ibu kota negara
konflik palestina vs israel
7 mayat mengapung di bekasi
kabinet prabowo gibran
ott kpk di maluku utara
|
tribunners hari apoteker sedunia 25 september 2024 pharmacists meeting global health needs
|
Links to external pages
Outloing links
account.tribunnews.com
account.tribunnews.com
travel.tribunnews.com
www.tribunnewswiki.com
shopping.tribunnews.com
health.tribunnews.com
trends.tribunnews.com
www.tribunnews.com
news.google.com
www.facebook.com
www.tiktok.com
video.tribunnews.com
video.tribunnews.com
video.tribunnews.com
video.tribunnews.com
video.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
shopping.tribunnews.com
www.tribunnewswiki.com
www.tribunnewswiki.com
www.tribunnewswiki.com
www.tribunjualbeli.com
jakarta.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
wartakota.tribunnews.com
jakarta.tribunnews.com
jakarta.tribunnews.com
jakarta.tribunnews.com
jakarta.tribunnews.com
www.kgmedia.id
SEO Advice for m.tribunnews.com
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 72% | A title should reflect the contents of a site. This site has a 55 % match | |
Title Length | 70% | Limit your title to anywhere between 40 and 70 characters. Your title was 86 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 85% | The meta description should be between 145 and 160 characters. This meta description is 136 characters long. | |
Meta description relevance | 72% | Meta Description should reflect the contents of a site. This site has a 40 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 243 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 15 level 1 folders and 19 folders above or in the first level of navigation. | |
Headings | 14% | Headers should reflect the contents of a site. This site has a 6 % match | |
Links | 10% | Link anchors should to some degree reflect the contents of a site. This site has a 5 % match | |
Image alt tags | 22% | Image alt tags should to some degree reflect the contents of a site. This site has a 8 % match | |
Html ratio | 60% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 99% | 99.186991869919 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 1775 words | |
Server response time | 30% | A slow server slows down a website. This server responds 430.21% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 29 inline style declarations ( <a style="color:green">) with a size of 772 bytes | |
Excessive use of the same words | 30% | There is an indication that there are one or more keywords that are used excessively. Rankwise flagged 1 word as spam | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 1 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (3) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (15) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
m.tribunnews.com images and descriptions
118 images found at m.tribunnews.com Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://asset-1.tstatic.net/img/tribunx/tribunx_small.png height: 40 width: 40 description: aplikasi tribun |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/tribunnews.svg height: 35 width: width attribute not set description: tribun |
|
https://asset-1.tstatic.net/img/lestari/lestari_rotate.gif height: 30 width: 30 description: lestari tribunnews |
|
https://asset-1.tstatic.net/img/lestari/text_lestari_putih.png height: 15 width: 99 description: lestari tribunnews |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/jokowi-groundbreaking-dprima-hotel-ikn_3.jpg height: height attribute not set width: width attribute not set description: jokowi-groundbreaking-dprima-hotel-ikn_3.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/anggota-dpr-foto-bersama-jelang-purna-tugas.jpg height: height attribute not set width: width attribute not set description: anggota-dpr-foto-bersama-jelang-purna-tugas.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/sidang-mantan-gubernur-maluku-utara-abdul-ghani-kasuba.jpg height: height attribute not set width: width attribute not set description: sidang-mantan-gubernur-maluku-utara-abdul-ghani-kasuba.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/guru-tampar-murid.jpg height: 122 width: 200 description: kronologis guru smp di lamongan tampar siswanya: korban panggil nama ke pelaku tanpa sapaan ibu |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/p-update-viral-video-asn-larang-tetangga-ibadah-sebut-berdoa-harus-ada-izin-berakhir-minta-maaf.jpg height: height attribute not set width: width attribute not set description: p-update-viral-video-asn-larang-tetangga-ibadah-sebut-berdoa-harus-ada-izin-berakhir-minta-maaf.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/kontainer-logistik.jpg height: 100 width: 130 description: kontainer-logistik.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/presiden-jokowi-usai-melakukan-groundbreaking-delonix-nusantara-321.jpg height: 100 width: 130 description: presiden-jokowi-usai-melakukan-groundbreaking-delonix-nusantara-321.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/20140515_105754_ilustrasi-tikam-menikam-tusuk.jpg height: 100 width: 130 description: 20140515_105754_ilustrasi-tikam-menikam-tusuk.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ketua-fraksi-pkb-mpr-ri-jazilul-fawaideqwdas.jpg height: 100 width: 130 description: ketua-fraksi-pkb-mpr-ri-jazilul-fawaideqwdas.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/jokowi-resmikan-groundbreaking-sekolah-internasional-ikn_3.jpg height: 100 width: 130 description: jokowi-resmikan-groundbreaking-sekolah-internasional-ikn_3.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ka-kondisi-taksaka-676.jpg height: 100 width: 130 description: ka-kondisi-taksaka-676.jpg |
|
https://img.youtube.com/vi/cxrqhnszmcs/mqdefault.jpg height: 122 width: 200 description: iriana jokowi pamit: saya minta maaf kalau ada salah selama ini, tanggal 20 oktober sudah purnatugas |
|
https://img.youtube.com/vi/69uefmp7kvm/mqdefault.jpg height: 122 width: 200 description: psi tak tahu soal rompi 'putra mulyono' yang dipakai kaesang: tiba-tiba dipakai saat blusukan |
|
https://img.youtube.com/vi/5lj9q3zgedu/mqdefault.jpg height: 122 width: 200 description: [full] adu kuat jenderal di pilkada jateng, pengamat: simpati mengalir ke andika 'banteng' dikeroyok |
|
https://img.youtube.com/vi/13gvi5xrm9g/mqdefault.jpg height: 122 width: 200 description: polisi periksa fans hingga teman lolly, hasil visum sementara anak nikita mirzani sudah keluar |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/kota-beirut-lebanon-dengan-pemandangan-pantainya-yang-memukau.jpg height: 140 width: 250 description: lebanon negara yang dikenal swiss-nya timur tengah itu kini diambang kehancuran akibat perang israel |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/tingkatan-tax-ratio-dirut-bri-sunarso-ungkap-pentingnya-memformalkan-umkm.jpg height: 100 width: 130 description: tingkatan-tax-ratio-dirut-bri-sunarso-ungkap-pentingnya-memformalkan-umkm.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/sultan-bachtiar-najamudin-mengunjungi-presiden-terpilih-prabowo-subianto.jpg height: 100 width: 130 description: sultan-bachtiar-najamudin-mengunjungi-presiden-terpilih-prabowo-subianto.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ilustrasi-hamil-9102019.jpg height: 100 width: 130 description: ilustrasi-hamil-9102019.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/a-umum-psi-kaesang-pangarep-me.jpg height: 122 width: 200 description: saat kaesang pakai rompi 'putra mulyono' kala blusukan dan bagi-bagi susu di tangerang |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/komeng-calon-wakil-ketua-mpr.jpg height: 122 width: 200 description: mengapa komeng yang dipilih jadi calon wakil ketua mpr? ini alasan para anggota dpd |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/ketua-umum-psi-kaesang-pangarep-mengenakan-rompi-bertuliskan-putra-mulyono.jpg height: 122 width: 200 description: ditanya alasan pakai rompi 'putra mulyono' saat blusukan di tangerang, begini reaksi kaesang |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/jokowi-resmikan-sekolah-internasional-di-ikn.jpg height: 122 width: 200 description: jokowi groundbreaking sekolah internasional di ikn, mampu tampung 750 siswa preschool hingga sma |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/images2/ruben-onsu-sarwendah-12.jpg height: 122 width: 200 description: sarwendah tak lagi dinafkahi, usai cerai, sepakat ruben onsu hanya biayai anak-anaknya |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ketua-mpr-ri-bambang-soesatyo-alias-bamsoet-saat-membuka-sidang-akhir-mpr-ri-periode-2019-2024.jpg height: 100 width: 130 description: ketua-mpr-ri-bambang-soesatyo-alias-bamsoet-saat-membuka-sidang-akhir-mpr-ri-periode-2019-2024.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/p-update-viral-video-asn-larang-tetangga-ibadah-sebut-berdoa-harus-ada-izin-berakhir-minta-maaf.jpg height: 100 width: 130 description: p-update-viral-video-asn-larang-tetangga-ibadah-sebut-berdoa-harus-ada-izin-berakhir-minta-maaf.jpg |
|
https://asset-1.tstatic.net/img/pilkada2024/pilkada_2024_widget.png height: 150 width: 300 description: banner pilkada 2024 |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/wawancara-khusus-menkominfo-budi-arie-setiadi_20240809_191315.jpg height: 100 width: 130 description: wawancara-khusus-menkominfo-budi-arie-setiadi_20240809_191315.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/presiden-jokowi-usai-melakukan-groundbreaking-delonix-nusantara.jpg height: 140 width: 250 description: sikapi serangan brutal israel, jokowi telepon menlu bahas pemulangan wni dari lebanon |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/kabid-humas-polda-metro-jaya-kombes-polisi-ade-ary-syam-indradi.jpg height: 100 width: 130 description: kabid-humas-polda-metro-jaya-kombes-polisi-ade-ary-syam-indradi.jpg |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/tribunshopping.svg height: 28 width: 120 description: tribun shopping logo |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/myra-wood-sea-memberikan-sensasi-wangi-yang-terkesan-elegan-dan-memikat.jpg height: 140 width: 220 description: review parfum lokal myra varian wood & sea, wanginya elegan tahan hingga 8 jam |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/5-manfaat-menggunakan-garam-himalaya-untuk-kecantikan-bisa-cegah-penuaan-dini.jpg height: 140 width: 220 description: 5 manfaat menggunakan garam himalaya untuk kecantikan, salah satunya bisa cegah penuaan dini |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/7-rekomendasi-serum-pria-untuk-perawatan-kulit-cerah-bebas-kusam.jpg height: 140 width: 220 description: 7 rekomendasi serum pria untuk perawatan kulit cerah bebas kusam |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/klinik-ke-100-dan-101-skin-dan-slim-merupakan-langkah-euromedica-group.jpg height: 140 width: 220 description: euromedica group buka klinik ke-100 dan ke-101 skin+ dan slim+ clinic |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/apple-macbook-pro-m2-2022.jpg height: 140 width: 220 description: 6 cara ini bakal bikin macbook kembali ngebut layaknya barang baru, wajib dicoba |
|
https://t-2.tstatic.net/shopping/foto/bank/thumbnails2/ilustrasi-bekicot-yang-menyukai-area-lembap.jpg height: 140 width: 220 description: 8 cara mengusir bekicot di sekitar rumah secara alami, terutama saat musim hujan tiba |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/gedung-kkp_20160129_144633.jpg height: 100 width: 130 description: gedung-kkp_20160129_144633.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ikn-ke-8.jpg height: 100 width: 130 description: ikn-ke-8.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/bekerja-sama-dengan-shopee-youtube-meluncurkan-program-youtube-shopping-affiliates-di-indonesia.jpg height: 100 width: 130 description: bekerja-sama-dengan-shopee-youtube-meluncurkan-program-youtube-shopping-affiliates-di-indonesia.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/prabowo-dan-gibran-pilpres-2024-05022024.jpg height: 100 width: 130 description: prabowo-dan-gibran-pilpres-2024-05022024.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/penemuan-mayat-bekasi-kjd.jpg height: 100 width: 130 description: penemuan-mayat-bekasi-kjd.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/situs-nippon-steel_3.jpg height: 100 width: 130 description: situs-nippon-steel_3.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/asap-mengepul-dari-sebuah-kota-di-lebanon-selatan-setel.jpg height: 140 width: 250 description: pbb: puluhan ribu warga terpaksa tinggalkan lebanon di tengah serangan israel |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/pejuang-hizbullah-terlibat-pertempuran-dengan-israel_20231025_213943.jpg height: 140 width: 250 description: 'senjata kiamat' hizbullah bisa bikin israel kewalahan jika nekat perang |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/juang-dari-kelompok-syiah-lebanon-hizbullah.jpg height: 100 width: 130 description: juang-dari-kelompok-syiah-lebanon-hizbullah.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/sebuah-rudal-iran-ditampilkan-saat-parade-militer.jpg height: 140 width: 250 description: 9 rudal iran yang bisa menjangkau israel meski jaraknya 1.770 km |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/pemukiman-yahudi-di-israel-tengah-yang-menjadi-sasaran-serangan-hizbullah.jpg height: 140 width: 250 description: hizbullah akan jerumuskan israel ke perang melelahkan, seperti yang dilakukan hamas |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/hizbullah-lebanon-meluncurkan-roket.jpg height: 140 width: 250 description: 2 eks pejabat pesimis israel bisa kalahkan hizbullah, sebut tel aviv kalah jauh dari segi kekuatan |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/penyelamat-berusaha-menye-an-yang-dibom-israel.jpg height: 140 width: 250 description: warga lebanon terjebak di bawah reruntuhan bangunan yang hancur dibom israel, 558 orang tewas |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/perbatasan-antara-wilayah-pendudukan-israel-dan-yordania.jpg height: 140 width: 250 description: sekutu dekat netanyahu: yordania bisa jadi target israel berikutnya setelah gaza dan lebanon |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/bsi-259.jpg height: 100 width: 130 description: bsi-259.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/presiden-aspek-indonesia-mirah-sumirat.jpg height: 100 width: 130 description: presiden-aspek-indonesia-mirah-sumirat.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/suasana-sidang-akhir-maja-jabatan-anggota-mpr-ri-periode-2019-2024.jpg height: 100 width: 130 description: suasana-sidang-akhir-maja-jabatan-anggota-mpr-ri-periode-2019-2024.jpg |
|
https://asset-2.tstatic.net/tribunnewswiki/foto/bank/images/xanthophobia-fobia-warna-kuning.jpg height: 250 width: 375 description: xanthophobia-fobia-warna-kuning.jpg |
|
https://asset-2.tstatic.net/tribunnewswiki/foto/bank/images/ptps-pengawas-tempat-pemungutan-suara.jpg height: 250 width: 375 description: ptps-pengawas-tempat-pemungutan-suara.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/dbreaking-magnum-re-f.jpg height: 100 width: 130 description: dbreaking-magnum-re-f.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ka-70-ka-taksaka-relasi-stasiun-gambir-yogyakarta.jpg height: 100 width: 130 description: ka-70-ka-taksaka-relasi-stasiun-gambir-yogyakarta.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/bank-mandiri-dukung-project-1mpact.jpg height: 100 width: 130 description: bank-mandiri-dukung-project-1mpact.jpg |
|
https://asset-1.tstatic.net/img/tnewsshortvideo.svg height: 40 width: 186 description: tribun shorts |
|
https://img.youtube.com/vi/dpnusc8jyby/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://img.youtube.com/vi/2_m3trff-n8/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://img.youtube.com/vi/lenzpooumzi/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://img.youtube.com/vi/bg4ecvop0bm/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://img.youtube.com/vi/xau9bv9xpuq/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://img.youtube.com/vi/wxfb_fpotxy/hqdefault.jpg height: 220 width: 210 description: tribunnews |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/smail-salismail-salivvv.jpg height: 100 width: 130 description: smail-salismail-salivvv.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/anggota-dpr-foto-bersama-jelang-purna-tugas.jpg height: 100 width: 130 description: anggota-dpr-foto-bersama-jelang-purna-tugas.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/area-persawahan-9112021.jpg height: 100 width: 130 description: area-persawahan-9112021.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/ketua-lma-ilwayab-dukung-penuh-program-cetak-sawah-dan-tidak-ada-penyerobotan-tanah-ulayat.jpg height: 100 width: 130 description: ketua-lma-ilwayab-dukung-penuh-program-cetak-sawah-dan-tidak-ada-penyerobotan-tanah-ulayat.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/jokowi-groundbreaking-dprima-hotel-ikn_3.jpg height: 100 width: 130 description: jokowi-groundbreaking-dprima-hotel-ikn_3.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/agus-gumiwang-gorishima-7.jpg height: 100 width: 130 description: agus-gumiwang-gorishima-7.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/parkiran-stasiun-bogor.jpg height: 100 width: 130 description: parkiran-stasiun-bogor.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/sidang-mantan-gubernur-maluku-utara-abdul-ghani-kasuba.jpg height: 100 width: 130 description: sidang-mantan-gubernur-maluku-utara-abdul-ghani-kasuba.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/keluarga-bachdim.jpg height: 100 width: 130 description: keluarga-bachdim.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/juru-bicara-kpk-tessa-mahardhika-sugiarto-tampil.jpg height: 100 width: 130 description: juru-bicara-kpk-tessa-mahardhika-sugiarto-tampil.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/jasa-raharja-polri-baksos.jpg height: 100 width: 130 description: jasa-raharja-polri-baksos.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/jasa-raharja-berikan-santunan-dan-jamin-biaya-perawatan-korban-kecelakaan-bus-dan-truk-di-pati.jpg height: 100 width: 130 description: jasa-raharja-berikan-santunan-dan-jamin-biaya-perawatan-korban-kecelakaan-bus-dan-truk-di-pati.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/guru-tampar-murid.jpg height: 100 width: 130 description: guru-tampar-murid.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/federico-chiesa-resmi-diperkenalkan-liverpool.jpg height: 100 width: 130 description: federico-chiesa-resmi-diperkenalkan-liverpool.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/a-umum-psi-kaesang-pangarep-me.jpg height: 100 width: 130 description: a-umum-psi-kaesang-pangarep-me.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/arsenal-menang-telak-atas-bayer-leverkusen-di-stadion-emirates.jpg height: 100 width: 130 description: arsenal-menang-telak-atas-bayer-leverkusen-di-stadion-emirates.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/dr-yu-uchiyama_3.jpg height: 100 width: 130 description: dr-yu-uchiyama_3.jpg |
|
https://asset-2.tstatic.net/tribunnews/foto/bank/thumbnails2/jokowi-prabowo-ikn-nihhhh.jpg height: 100 width: 130 description: jokowi-prabowo-ikn-nihhhh.jpg |
|
https://asset-1.tstatic.net/img/logo/tribun/svg/tribunjualbeli.svg height: 33 width: 150 description: tribunjualbeli logo |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900290/0-508860107-rumah-2-lantai-nyaman-di-jantung-cimahi-didekat-pemkot-cimahi-thumb.jpg height: 90 width: 120 description: dijual rumah 2 lantai nyaman di jantung cimahi didekat pemkot - cimahi |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900280/0-60636308-wa-0823-3766-4403--toko-kursi-kantor-nyaman-surabaya-thumb.jpg height: 90 width: 120 description: toko kursi kantor nyaman - surabaya |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900287/0-1383037674-hub-0852-2507-8715-dijamin-aman--ayunan-besi-bulat-besar-dan-mainan-playground-thumb.jpg height: 90 width: 120 description: dijamin aman ayunan besi bulat besar dan mainan playground - garut |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900283/0-115468029-wa-0822-4040-9293-mukena-bordir-tangan-kirim-ke-ampana-kota-tojo-una-una-thumb.jpg height: 90 width: 120 description: mukena bordir tangan - pasuruan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900260/0-1160042166-software-aplikasi-kasir-fitur-canggih-thumb.jpg height: 90 width: 120 description: software aplikasi kasir fitur canggih - mojokerto |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900278/0-1493987944-dijual-rumah-desain-modern-dekat-ringroad-selatan-kasihan-bantul-thumb.jpg height: 90 width: 120 description: dijual rumah 2kt 1km shm desain modern dekat ringroad selatan kasihan bantul - jogja |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900277/0-272463038-wa-0822-4040-9293-mukena-polos-premium-kirim-ke-jayapura-thumb.jpg height: 90 width: 120 description: mukena polos premium - pasuruan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900269/0-1823408006-dijual-tanah-jalan-28-oktober-kota-pontianak-thumb.jpg height: 90 width: 120 description: dijual tanah luas 1320m2 shm jalan 28 oktober - kota pontianak |
|
https://asset-3.tstatic.net/jualbeli/img/2024/7/2857584/0-1436337403-travel-umroh-yang-bagus-di-surabaya-thumb.jpg height: 90 width: 120 description: travel umroh yang bagus - surabaya jawa timur |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900274/0-692449990-tanah-murah-shm-p-kota-wonosari-gunungkidul-thumb.jpg height: 90 width: 120 description: dijual tanah murah luas 60m shm p kota wonosari gunungkidul - jogja |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900251/0-2102784049-jasa-konstruksi-baja-ringan-rumah-minimalis-di-gresik--jasa-konstruksi-baja-ring-thumb.jpg height: 90 width: 120 description: jasa konstruksi baja ringan rumah minimalis - gresik |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900250/0-472434293-hub-0852-2507-8715-free-ongkir--ayunan-besi-minimalis-dan-mangkok-putar-kec-cik-thumb.jpg height: 90 width: 120 description: ayunan besi minimalis dan mangkok putar - garut |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900264/0-2030711794-wa-0823-3766-4403--toko-kursi-kerja-bos-malang-thumb.jpg height: 90 width: 120 description: toko kursi kerja bos - malang kota |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900247/0-1367218355-free-ongkir-bayar-cod-playground-mainan-outdoor-anak-mijen-demak-thumb.jpg height: 90 width: 120 description: playground mainan outdoor anak mijen - demak |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900246/0-2036365322-jasa-konstruksi-atap-rumah-tinggal-di-gresik--jasa-konstruksi-baja-ringan-rumah-thumb.jpg height: 90 width: 120 description: jasa konstruksi atap rumah tinggal - gresik |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900263/0-836794164-wa-0822-4040-9293-supplier-tangan-pertama-mukena-kirim-ke-tondano-minahasa-thumb.jpg height: 90 width: 120 description: supplier tangan pertama mukena - pasuruan |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900267/0-1237413653-dijual-rumah-97-murah-paulan-colomadu-solo-dekat-jalan-adi-sucipto-thumb.jpg height: 90 width: 120 description: dijual rumah 97 murah paulan colomadu solo dekat jalan adi sucipto - surakarta |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900265/0-1718199088-hub-0852-2507-8715-terpecaya--ayunan-besi-bulat-dan-mainan-outdoor-untuk-tk-ke-thumb.jpg height: 90 width: 120 description: terpecaya ayunan besi bulat dan mainan outdoor untuk tk - garut |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900242/0-1934274333-wa-0851.5060.4662--travel-umroh-haji-terbaik-di-mulyorejo-surabaya-timur-thumb.jpg height: 90 width: 120 description: travel umroh haji terbaik di mulyorejo - surabaya |
|
https://asset-3.tstatic.net/jualbeli/img/2024/9/2900266/0-1739513242-terpercaya-0852-5877-3400--konsultan-bisnis-online-bagi-pemula-di-badung--kons-thumb.jpg height: 90 width: 120 description: konsultan bisnis online bagi pemula - sidoarjo |
|
https://asset-2.tstatic.net/jakarta/foto/bank/thumbnails2/kecelakaan-hari-ini-di-bantul-truk-molen-nekat-melintas-akhirnya-tertabrak-kereta-api-taksaka.jpg height: 150 width: 200 description: kecelakaan-hari-ini-di-bantul-truk-molen-nekat-melintas-akhirnya-tertabrak-kereta-api-taksaka.jpg |
|
https://asset-2.tstatic.net/wartakota/foto/bank/thumbnails2/nikita-mirzani-ungkap-kondisi-lolly-saat-ini-vibesnya-sudah-beda.jpg height: 150 width: 200 description: nikita-mirzani-ungkap-kondisi-lolly-saat-ini-vibesnya-sudah-beda.jpg |
|
https://asset-2.tstatic.net/wartakota/foto/bank/thumbnails2/irjen-karyoto-karyoto-datang-ke-tkp-ditemukannya-tujuh-pria-yang-tewas-mengapung.jpg height: 150 width: 200 description: irjen-karyoto-karyoto-datang-ke-tkp-ditemukannya-tujuh-pria-yang-tewas-mengapung.jpg |
|
https://asset-2.tstatic.net/wartakota/foto/bank/thumbnails2/kapolda-jateng-irjen-pol-ribut-hari-wibowo-menghindari-uluran-tangan-dari-andika-perkasa.jpg height: 150 width: 200 description: kapolda-jateng-irjen-pol-ribut-hari-wibowo-menghindari-uluran-tangan-dari-andika-perkasa.jpg |
|
https://asset-2.tstatic.net/wartakota/foto/bank/thumbnails2/12-hotel-di-jakarta-dengan-tarif-dibawah-500-ribuan.jpg height: 150 width: 200 description: 12-hotel-di-jakarta-dengan-tarif-dibawah-500-ribuan.jpg |
|
https://asset-2.tstatic.net/wartakota/foto/bank/thumbnails2/ilustrasi-lokasi-layanan-sim-keliling.jpg height: 150 width: 200 description: ilustrasi-lokasi-layanan-sim-keliling.jpg |
|
https://asset-2.tstatic.net/jakarta/foto/bank/thumbnails2/muhammad-rizki-19-satu-dari-tujuh-mayat-kali-bekas.jpg height: 150 width: 200 description: muhammad-rizki-19-satu-dari-tujuh-mayat-kali-bekas.jpg |
|
https://asset-2.tstatic.net/jakarta/foto/bank/thumbnails2/pelaku-ise-23-kanan-dendam-karena-pernah-jadi-korban-penyiraman-air-keras.jpg height: 150 width: 200 description: pelaku-ise-23-kanan-dendam-karena-pernah-jadi-korban-penyiraman-air-keras.jpg |
|
https://b.scorecardresearch.com/p?c1=2&c2=8077308&cv=2.0&cj=1 height: height attribute not set width: width attribute not set description: no alt description found |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!