en.wikipedia.org website review
![](/include/images/menno/screenl1.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/screenl2.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/highlight.png)
Improve your SEO :: free trial!
en.wikipedia.org is 62% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/hawa_mahal,_visakhapatnam
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be visakhapatnam
Focus keyword
Short and long tail
Short Tail Keywords visakhapatnam palace was |
long Tail Keywords (2 words) hawa mahal sidebar hide andhra pradesh bus station hospital government |
long Tail Keywords (3 words) move to sidebar east india company times of india college of engineering ram chandra dev 6 april 2021 chandra dev iv |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/hawa_mahal,_visakhapatnam page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
hawa mahal visakhapatnam wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia map visakhapatnam city district green wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/hawa_mahal,_visakhapatnam
Mobile rendering
![](/include/images/menno/screenl1.png)
![](/include/images/menno/screenl2.png)
![](/include/images/menno/highlight.png)
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
![](/include/images/icons/loader.gif)
![](/include/images/icons/loader.gif)
Marketing / lead generation for en.wikipedia.org/wiki/hawa_mahal,_visakhapatnam
Social Media
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
hawa found in path !
mahal found in path !
visakha found in path !
visakhapatnam found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Favicon icon found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Robots.txt found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Sitemap found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlehawamahalvisakhapatnamoldid1163258424
page information
printable version
vizag warriors
|
wiki indogothic architecture
beach road
coordinates
maharaja of jeypore
jeypore
madras
prime minister of india
jawaharlal nehru
president of india
rajendra prasad
rabindranath tagore
vicechancellor
andhra university
dr sarvepalli radhakrishnan
waheeda rahman
burma
grecian
hindi
telugu cinema
kamal haasan
ek duuje ke liye
singam 3
hari
suriya
anushka shetty
shruti haasan
visakhapatnam
history
satavahanas
pallavas
eastern chalukyas
chola dynasty
kakatiya dynasty
vijayanagara empire
qutb shahi dynasty
nizam of hyderabad
dutch east india company
east india company
french east india company
battle of vizagapatam
northern circars
company raj
visakhapatnam gas leak
administration
andhra pradesh eastern power distribution company limited
greater visakhapatnam municipal corporation
visakhapatnam city police
visakhapatnam district collectorate
visakhapatnam metropolitan region development authority
bay of bengal
dolphins nose
eastern ghats
erra matti dibbalu
gosthani river
kambalakonda wildlife sanctuary
kanithi balancing reservoir
kondakarla ava
meghadri gedda reservoir
mudasarlova reservoir
raiwada reservoir
simhachalam hill range
tatipudi reservoir
yarada hills
economy
andhra pradesh medtech zone
andhra pradesh sez
coromandel fertilizers
dredging corporation of india
essar pellet plant
fintech valley vizag
gangavaram port
hindustan shipyard
jawaharlal nehru pharma city
millennium it towers
naval dockyard
ntpc simhadri
visakha dairy
visakhapatnamchennai industrial corridor
visakhapatnam port
visakhapatnam refinery
visakhapatnam sez
visakhapatnam steel plant
vizag backtoback hvdc converter station
vizag thermal power station
transport
bhogapuram airport
visakhapatnam airport
duvvada railway station
duvvadavijayawada section
simhachalam railway station
south coast railway zone
visakhapatnam metro
visakhapatnam railway station
waltair railway division
dwaraka bus station
maddilapalem bus station
mvp colony bus station
nad x road
nowroji road
raipurvisakhapatnam expressway
rama talkies road
sankara matam road
simhachalam bus station
telugu thalli flyover
town kotha road
visakhapatnam brts
vip road
waltair main road
culture
telugu
uttarandhra dialect
bavikonda
bojjannakonda
pavurallakonda
thotlakonda
bheemili beach
rk beach
rushikonda beach
yarada beach
cmr central
visakhapatnam central
biodiversity park
city central park
indira gandhi zoological park
mudasarlova park
sivaji park
kailasagiri
shilparamam jathara
tenneti park
vmrda health arena
vuda park
ins kursura submarine museum
queen victoria pavilion
telugu samskruthika niketanam
tu 142 aircraft museum
victory at sea memorial
visakha museum
araku balloon festival
international fleet review
navy day
visakha utsav
au convention center
childrens arena
gurajada kalakshetram
kala bharati
rajiv smruthi bhavan
town hall
turners choultry
telugu titans
dr y s rajashekar reddy acavdca cricket stadium
hindustan zinc limited ground
indira priyadarshini stadium
port trust diamond jubilee stadium
south coast railway stadium
swarna bharathi indoor stadium
ukku stadium
andhra pradesh assembly
anakapalle
bheemili
gajuwaka
pendurthi
visakhapatnam east
visakhapatnam north
visakhapatnam south
visakhapatnam west
lok sabha
visakhapatnam
anakapalli
educational institutions
damodaram sanjivayya national law university
gitam institute of medical sciences and research
indian maritime university
andhra university college of engineering
anil neerukonda institute of technology and sciences
chaitanya engineering college
gayatri vidya parishad college of engineering
indian institute of petroleum and energy
raghu engineering college
pydah college of engineering and technology
vignans institute of information technology
andhra medical college
dr v s krishna govt degree pg college
dr lankapalli bullayya college
mrs a v n college
stjosephs college for women
visakha govt degree college for women
iim visakhapatnam
dr b r ambedkar college of law
gitam school of law
visakha law college
kalam institute of health technology
dps visakhapatnam
oakridge international school
srikrishna vidya mandir
st aloysius angloindian high school
timpany school
visakha valley school
government ent hospital
government hospital for mental care
government regional eye hospital
government tb and chest hospital
government victoria hospital
homi bhabha cancer hospital research centre
king george hospital
rani chandramani devi government hospital
visakha institute of medical sciences
apollo hospitals
l v prasad eye institute
sevenhills hospital
devipuram temple
iskcon temple
kali temple
nookambika temple
simhachalam temple
sri kanaka maha lakshmi temple
sri sampath vinayagar temple
sri someswara swamy temple
quirk memorial baptist church
st stephens orthodox church
list of cities in india by population
list of largest cities
|
Links to external pages
Outloing links
www.wikidata.org
www.wikidata.org
commons.wikimedia.org
geohack.toolforge.org
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 38 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 254 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 76% | Headers should reflect the contents of a site. This site has a 33 % match | |
Links | 14% | Link anchors should to some degree reflect the contents of a site. This site has a 7 % match | |
Image alt tags | 70% | Image alt tags should to some degree reflect the contents of a site. This site has a 25 % match | |
Bold and italic | 100% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 44 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 46% | 46.153846153846 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 1618 words | |
Server response time | 30% | A slow server slows down a website. This server responds 308.01% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 155 inline style declarations ( <a style="color:green">) with a size of 2554 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
13 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/1/1a/hawa_mahal_of_visakhapatnam.jpg/250px-hawa_mahal_of_visakhapatnam.jpg height: 165 width: 250 description: no alt description found |
|
https://maps.wikimedia.org/img/osm-intl,13,17.707458,83.311838,250x200.png?lang=en&domain=en.wikipedia.org&title=hawa_mahal%2c_visakhapatnam&revid=1163258424&groups=_0a40db0b0e621909bc998616818f92f65e52ea83 height: 200 width: 250 description: map |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/e/e1/interior_of_hawa_mahal_palace.jpg/220px-interior_of_hawa_mahal_palace.jpg height: 134 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/8/82/visakhapatnam_montage_01.png/150px-visakhapatnam_montage_01.png height: 216 width: 150 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/a/ab/visakhapatnam_revenue_division_in_visakha_district.png/150px-visakhapatnam_revenue_division_in_visakha_district.png height: 126 width: 150 description: visakhapatnam city district in green |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/96/symbol_category_class.svg/16px-symbol_category_class.svg.png height: 16 width: 16 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/4a/commons-logo.svg/12px-commons-logo.svg.png height: 16 width: 12 description: no alt description found |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/static/images/footer/poweredby_mediawiki.svg height: 29 width: 84 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!