en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 56% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/kavalam_narayana_panicker
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be kavalam
Focus keyword
Short and long tail
Short Tail Keywords kavalam narayana nair |
long Tail Keywords (2 words) kavalam narayana narayana panicker madhava chakyar k p erin b |
long Tail Keywords (3 words) kavalam narayana panicker sangeet natak akademi mee erin b mani madhava chakyar ammannur madhava chakyar kavalam narayana panikkar k m george |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/kavalam_narayana_panicker page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
kavalam narayana panicker wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia edit wikidata wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/kavalam_narayana_panicker
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/kavalam_narayana_panicker
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
kavalam found in path !
narayana found in path !
panicker found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlekavalamnarayanapanickeroldid1246168324
page information
printable version
thoppil varghese antony
g v iyer ramakrishna
|
wiki k m panikkar
k n panikkar
k ayyappa panicker
kavalam
travancore
thiruvananthapuram
kerala
kavalam sreekumar
sanskrit drama
shakespeare
kalidasa
bhasa
trivandrum
sangeet natak akademi award
sangeet natak akademi
sangeet natak akademi fellowship
padma bhushan female
government of india
kuttanad
alappuzha
kavalam madhava panikkar
malayalam
cms college
kottayam
k p s menon
sanatana dharma college
madras law college
kerala sangeetha nadaka academy thrissur
thrissur
g aravindan
soviet union
greece
ramayana
iliad
kutiyattam
mani madhava chakyar
kuttiyattam
ravana
malayalam films
manjadikuru
marmaram
kerala state film award
best lyrics
cancer
kerala sangeetha nataka akademi fellowship
kalidas samman
government of madhya pradesh
amen
asiavision awards
isbn
malayala manorama
wayback machine
imdb
v k aatre
anil agarwal
ram narain agarwal
sharan rani backliwal
swami kalyandev
veerendra heggade
pavaguda v indiresan
wahiduddin khan
b b lal
raghunath anant mashelkar
h y sharada prasad
rajinikanth
begum aizaz rasul
raja and radha reddy
pakkiriswamy chandra sekharan
karamshi jethabhai somaiya
s srinivasan
ratan tata
harbans singh wasir
dev anand
viswanathan anand
amitabh bachchan
rahul bajaj
b r barwale
balasaheb bharde
boyi bhimanna
swadesh chatterjee
b r chopra
ashok desai
k m george
bhupen hazarika
lalgudi jayaraman
yamini krishnamurthy
shiv k kumar
raghunath mohapatra
arun netravali
mohan singh oberoi
rajendra k pachauri
abdul karim parekh
amrita patel
pran
aroon purie
b v raju
p bhanumathi
sundaram ramakrishnan
chitranjan singh ranawat
palle rama rao
raj reddy
uma sharma
l subramaniam
naresh trehan
gary ackerman
h p s ahluwalia
prabha atre
sushantha kumar bhattacharyya
chandu borde
eugene chelyshev
pravinchandra varjivan gandhi
shobha gurtu
henning holcklarsen
zakir hussain
b k s iyengar
f c kohli
v c kulandaiswamy
gury marchuk
jagat singh mehta
ismail merchant
mario miranda
frank pallone
ramanujam varatharaja perumal
natesan rangabashyam
maharaja krishna rasgotra
habib tanvir
k k venugopal
nirmal verma
k j yesudas
teejan bai
ammannur madhava chakyar
prabhu chawla
herbert fischer
jamshyd godrej
coluthur gopalan
k parasaran
b rajam iyer
shri krishna joshi
madurai narayanan krishnan
rajinder kumar
ramesh kumar
purshotam lal
sitakant mahapatra
bagicha singh minhas
subhash mukhopadhyay
p s narayanaswamy
arcot ramachandran
trichur v ramachandran
kantilal hastimal sancheti
t v sankaranarayanan
naseeruddin shah
t v r shenoy
jagjit singh
ram badan singh
hari shankar singhania
umayalpuram k sivaraman
narayanan srinivasan
padma subrahmanyam
swapna sundari
o v vijayan
herbert alexandrovich yefremov
soumitra chatterjee
chandrashekhar shankar dharmadhikari
gulzar
sardara singh johl
m v kamath
komal kothari
yoshir mori
gopi chand narang
govindarajan padmanaban
poornima arvind pakvasa
vishnu prabhakar
n rajam
c h hanumantha rao
thiruvengadam lakshman sankar
t n seshagopalan
bijoy nandan shahi
krishna srinivas
alarmel valli
sardar anjum
andr beteille
chandi prasad bhatt
tumkur ramaiya satishchandran
mrinal datta chaudhuri
yash chopra
manna dey
irfan habib
yusuf hamied
qurratulain hyder
tarlochan singh kler
anil kohli
kiran mazumdarshaw
mrinal miri
brijmohan lall munjal
m t vasudevan nair
azim premji
balraj puri
syed mir qasim
a ramachandran
v s ramamurthy
k i varaprasad reddy
k srinath reddy
girish chandra saxena
narasimaiah seshagiri
mark tully
jaiveer agarwal
p s appu
shashi bhushan
ganga prasad birla
grigory bongardlevin
lokesh chandra
chiranjeevi
dinesh nandini dalmia
tarun das
madhav gadgil
a k hangal
devaki jain
kamleshwar
abdul halim jaffer khan
sabri khan
ghulam mustafa khan
shanno khurana
p leela
k p p nambiar
nandan nilekani
sai paranjpye
deepak parekh
m v pylee
subramaniam ramadorai
n s ramaswamy
pavani parameswara rao
ramakanta rath
v shanta
hira lall sibal
billy arjan singh
jasjit singh
vijaypat singhania
k g subramanyan
k k talwar
vijay shankar vyas
duan zbavitel
javed akhtar
gabriel chiramel
ela gandhi
saroj ghose
v mohini giri
somnath hore
jamshed jiji irani
gurcharan singh kalkat
n mahalingam
prithipal singh maini
tyeb mehta
rajan and sajan mishra
sunil mittal
ramankutty nair
gopaldas neeraj
indra nooyi
bhikhu parekh
syed mohammad sharfuddin quadri
v s ramachandran
tapan raychaudhuri
s h raza
jeffrey sachs
chandra prasad saikia
l z sailo
shiv kumar sarin
shriram sharma
manju sharma
t n srinivasan
osamu suzuki
k t thomas
mian bashir ahmed
kaushik basu
shayama chona
jagjit singh chopra
rahim fahimuddin dagar
chandrashekhar dasgupta
asis datta
meghnad desai
padma desai
sukh dev
nirmal kumar ganguly
b n goswamy
vasant gowarikar
baba kalyani
k v kamath
inderjit kaur barthakur
ravindra kelekar
asad ali khan
dominique lapierre
d r mehta
shiv nadar
suresh kumar neotia
t k oommen
k padmanabhaiah
vikram pandit
v ramachandran
sushil kumar saxena
amarnath sehgal
jasdev singh
shrilal shukla
p susheela
s r srinivasa varadhan
yuli vorontsov
sunita williams
ji xianlin
isher judge ahluwalia
shamshad begum
abhinav bindra
v p dhananjayan
ramachandra guha
shekhar gupta
khalid hameed
minoru hara
jayakanthan
thomas kailath
sarvagya singh katiyar
g krishna
r c mehta
a sreedhara menon
s k misra
a m naik
satish nambiar
kunwar narayan
nagnath naikwadi
kirit parikh
sam pitroda
c k prahalad
gurdip singh randhawa
brijendra kumar rao
bhakta b rath
c s seshadri
v ganapati sthapati
devendra triguna
sarojini varadappan
padma vibhushan
adoor gopalakrishnan
e c george sudarshan
e sreedharan
g madhavan nair
john matthai
k n raj
k r ramanathan
k shankar pillai
kottayan katankot venugopal
m s valiathan
n r pillai
o n v kurup
v k krishna menon
v r krishna iyer
verghese kurien
a c n nambiar
c p krishnan nair
chembai
eledath thaikkattu narayanan mooss
g sankara kurup
george joseph scientist
guru kunchu kurup
jacob chandy
k m mathew
k p kesava menon
k p s menon senior
k radhakrishnan
k sankaran nair
k sukumaran
k t thomas justice
kandathil mammen cherian
kunhiraman palat candeth
kuzhur narayana marar
madavoor vasudevan nair
mannathu padmanabha pillai
mohanlal
p k warrier
palghat mani iyer
philipose mar chrysostom mar thoma
pothan joseph
prem nazir
raghavan thirumulpad
t j s george
t n krishnan
t v gopalakrishnan
thakazhi sivasankara pillai
thayil john cherian
v k narayana menon
vainu bappu
vallathol narayana menon
balamani amma
lakshmi n menon
tara cherian
padma shri female
a marthanda pillai
a sivathanu pillai
antony padiyara
ayyappa paniker
azad moopen
b paul thaliath
b ravi pillai
balachandra menon
c g krishnadas nair
cheril krishna menon
eledath thaikkattu neelakandan mooss
eluvathingal devassy jemmis
g shankar
g vijayaraghavan
gopinath pillai
j hareendran nair
jayaram
jose chacko periappuram
k m mammen mappillai
k p haridas
k p udayabhanu
k raghavan
k ravindran nair
kalamandalam gopi
kalamandalam krishnan nair
kalamandalam sivan namboodiri
kandathil mammen philip
kavungal chathunni panicker
keezhpadam kumaran nair
kunnenkeril k jacob
kurian john melamparambil
kuzhivelil mathew
laurie baker
madhavan chandradathan
m a yousuf ali
m g ramachandran
m krishnan nair doctor
m night shyamalan
m r kurup
m vijayan
madhu actor
mammen mathew
mammootty
mathew kalarickal
mattannoor sankarankutty
mitraniketan viswanathan
n balakrishnan nair
n kesava panikkar
n r madhava menon
narayana panicker kochupillai
neyyattinkara vasudevan
p gopinathan
p k narayanan nambiar
p k rajagopalan
p parameswaran
paul pothen
perakath verghese benjamin
peruvanam kuttan marar
philip augustine
priyadarshan
pucadyil ittoop john
puthenpurayil mathew joseph
r marthanda varma
r k krishna kumar
rajagopalan krishnan
resul pookutty
shaji n karun
sooranad kunjan pillai
stanley john
sunny varkey
t k alex
thikkurissy sukumaran nair
thilakan
thomas kunnunkal
vaikom muhammad basheer
vazhenkada kunchu nair
vellayani arjunan
vishnunarayanan namboothiri
achamma mathai
anju bobby george
dipika pallikal
k m beenamol
k s chithra
kalamandalam kshemavathy
kalamandalam satyabhama
leela omchery
lucy oommen
m d valsamma
m leelavathy
m subhadra nair
mary poonen lukose
mary verghese
p t usha
pepita seth
rachel thomas skydiver
shiny abraham
shobana
sudha varghese
sugathakumari
sukumari
thangam philip
usha uthup
lakshmikutty
vidya balan
sangeet natak akademi fellowship
allauddin khan
hafiz ali khan
ariyakudi ramanuja iyengar
karaikudi sambasiva iyer
prithviraj kapoor
anjanibai malpekar
gopeshwar banerjee
uday shankar
papanasam sivan
shrikrishna narayan ratanjankar
pichu sambamoorthi
mama warerkar
t l venkatarama aiyar
b r deodhar
v raghavan
p v rajamannar
vinayakrao patwardhan
dilipkumar roy
jaideva singh
ashutosh bhattacharya
e krishna iyer
sombhu mitra
jayachamarajendra wadiyar
ebrahim alkazi
rukmini devi arundale
musiri subramania iyer
bade ghulam ali khan
shambhu maharaj
v satyanarayana sarma
adya rangacharya
kali charan patnaik
kapila vatsyayan
tarapada chakraborty
krishnarao phulambrikar
rallapalli ananta krishna sharma
shivaram karanth
kamaladevi chattopadhyay
jnan prakash ghosh
m s subbulakshmi
t balasaraswati
zubin mehta
rasiklal parikh
ravi shankar
santidev ghosh
semmangudi srinivasa iyer
b puttaswamayya
purushottam laxman deshpande
sumati mutatkar
mallikarjun mansur
chandravadan mehta
siyaram tiwari
s ramanathan
satyajit ray
shivaputra siddaramayya komkali kumar gandharva
lata mangeshkar
utpal dutt
ram gopal
alain danilou
kelucharan mohapatra
ali akbar khan
d k pattammal
prem lata sharma
girish karnad
mrinalini sarabhai
bismillah khan
yehudi menuhin
maheswar neog
vilayat khan
gangubai hangal
badal sarkar
bhimsen joshi
birju maharaj
k p kittappa pillai
vijay tendulkar
m balamuralikrishna
b v karanth
vempati chinna satyam
chandralekha
annapurna devi
bindhyabasini devi
zohra sehgal
tapas sen
rohini bhate
kishan maharaj
ningthoukhongjam khelchandra
khaled choudhury
sitara devi
kishori amonkar
jasraj
shriram lagoo
kamlesh dutt tripathi
girija devi
t k murthy
nataraja ramakrishna
m chandrasekaran
hariprasad chaurasia
chandrashekhara kambara
heisnam kanhailal
mukund lath
shivkumar sharma
rajkumar singhajit singh
amjad ali khan
ratan thiyam
t h vinayakram
mahesh elkunchwar
kanak rele
r sathyanarayana
tulsidas borkar
s r janakiraman
m s sathyu
c v chandrasekhar
arvind parikh
r vedavalli
ram gopal bajaj
sunil kothari
jatin goswami
sonal mansingh
saroja vaidyanathan
sadanam krishnankutty
darshana jhaveri
chhannulal mishra
a k c natarajan
swapan chaudhuri
malini rajurkar
bharat gupt
r visweswaran
sunayana hazarilal
daya prakash sinha
chembai vaidyanatha bhagavathar
k v narayanaswamy
b sasikumar
guruvayur dorai
palghat r raghu
champakulam pachu pillai
chenganoor raman pillai
guru gopinath
kalamandalam rajan
kottakkal chandrasekharan
kottakkal sivaraman
madambi subramanian namboodiri
mankompu sivasankara pillai
nelliyode vasudevan namboodiri
padmanabhan nair
sadanam p v balakrishnan
vasu pisharody
vazhenkada vijayan
kalamandalam kuttan asan
m p s namboodiri
ramachandran unnithan
thonnakkal peethambaran
varanasi vishnu namboothiri
deepti omchery bhalla
gopika varma
kalamandalam kalyanikutty amma
kalamandalam leelamma
kalamandalam sugandhi
vimala menon
v k hymavathy
kalamandalam gangadharan
n n pillai
kavalam narayana panikkar
neralattu rama poduval
appukutty poduval
kerala sahitya akademi fellowship
puthezhath raman menon
joseph mundasseri
v t bhattathiripad
n krishna pillai
n balamani amma
v unnikrishnan nair
p kesavadev
vailoppilli sreedhara menon
lalithambika antharjanam
r e asher
n v krishna warrier
kainikkara kumara pillai
t m chummar
ponkunnam varkey
m p appan
c n ahmad moulavi
sukumar azhikode
m p sankunni nair
k surendran
s gupthan nair
v k n
kovilan
p bhaskaran
thikkodiyan
kamala surayya
k satchidanandan
c radhakrishnan
yusuf ali kecheri
n s madhavan
sara joseph
u a khader
attoor ravi varma
k g sankara pillai
m mukundan
p valsala
n v p unithiri
sethu
perumbadavam sreedharan
vaisakhan
k p sankaran
|
Links to external pages
Outloing links
hi.wikipedia.org
ml.wikipedia.org
arz.wikipedia.org
pl.wikipedia.org
ru.wikipedia.org
ta.wikipedia.org
www.wikidata.org
www.wikidata.org
commons.wikimedia.org
web.archive.org
web.archive.org
web.archive.org
www.indereunion.net
web.archive.org
www.msidb.org
www.keralaculture.org
web.archive.org
commons.wikimedia.org
www.devaragam.com
web.archive.org
web.archive.org
www.bhasabharathi.com
web.archive.org
www.isni.org
www.viaf.org
id.worldcat.org
id.oclc.org
www.d-nb.info
id.loc.gov
catalogue.bnf.fr
data.bnf.fr
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 98% | A title should reflect the contents of a site. This site has a 75 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 38 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 867 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 44% | Headers should reflect the contents of a site. This site has a 19 % match | |
Links | 6% | Link anchors should to some degree reflect the contents of a site. This site has a 3 % match | |
Image alt tags | 31% | Image alt tags should to some degree reflect the contents of a site. This site has a 11 % match | |
Bold and italic | 45% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 15 % match | |
Html ratio | 40% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 38% | 38.461538461538 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 3584 words | |
Server response time | 30% | A slow server slows down a website. This server responds 327.87% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 30% | There are no important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 137 inline style declarations ( <a style="color:green">) with a size of 2372 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
13 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/7/73/kavalam.jpg/225px-kavalam.jpg height: 234 width: 225 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/2/23/kavalam_narayana-panicker.jpg/220px-kavalam_narayana-panicker.jpg height: 146 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/0/03/kavalam_narayana_panicker_image1.jpg/170px-kavalam_narayana_panicker_image1.jpg height: 257 width: 170 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/d/db/kavalam_-_narayana_panicker.jpg/220px-kavalam_-_narayana_panicker.jpg height: 145 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/b/b5/kavalam_narayana_panicker.jpg/220px-kavalam_narayana_panicker.jpg height: 146 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/4a/commons-logo.svg/30px-commons-logo.svg.png height: 40 width: 30 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/8/8a/oojs_ui_icon_edit-ltr-progressive.svg/10px-oojs_ui_icon_edit-ltr-progressive.svg.png height: 10 width: 10 description: edit this at wikidata |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/w/resources/assets/poweredby_mediawiki.svg height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!