en.wikipedia.org website review
![](/include/images/menno/screenl1.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/screenl2.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/highlight.png)
Improve your SEO :: free trial!
en.wikipedia.org is 74% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/kristin_lavransdatter_(film)
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be film
Focus keyword
Short and long tail
Short Tail Keywords film norwegian wikipedia |
long Tail Keywords (2 words) kristin lavransdatter sidebar hide foreign language can help see also |
long Tail Keywords (3 words) move to sidebar directed by liv stub you can can help wikipedia wikipedia by expanding award for best kristin lavransdatter film |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/kristin_lavransdatter_(film) page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
kristin lavransdatter film wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia edit wikidata stub icon wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/kristin_lavransdatter_(film)
Mobile rendering
![](/include/images/menno/screenl1.png)
![](/include/images/menno/screenl2.png)
![](/include/images/menno/highlight.png)
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
![](/include/images/icons/loader.gif)
![](/include/images/icons/loader.gif)
Marketing / lead generation for en.wikipedia.org/wiki/kristin_lavransdatter_(film)
Social Media
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
film found in path !
kristin found in path !
lavransdatter found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Favicon icon found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Robots.txt found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Sitemap found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlekristinlavransdatterfilmoldid1227412323
page information
printable version
esben hilund carlsen
ketil hvoslef
elisabeth matheson
|
wiki liv ullmann
sigrid undset
jrgen langhelle
lena endre
sverre anker ousdal
erland josephson
sven nykvist
michal leszczylowski
bjrn skagestad
kristin lavransdatter
best foreign language film
68th academy awards
list of historical drama films
list of submissions to the 68th academy awards for best foreign language film
list of norwegian submissions for the academy award for best foreign language film
screen international
imdb
sofie
lumire and company
private confessions
faithless
miss julie
norwegian submissions
academy award
best international feature film
elling
kissed by winter
hawaii oslo
kitchen stories
hold my heart
reprise
gone with the woman
o horten
angel
happy happy
kontiki
i am yours
1001 grams
the wave
the kings choice
thelma
what will people say
out stealing horses
hope
the worst person in the world
war sailor
songs of earth
|
Links to external pages
Outloing links
da.wikipedia.org
it.wikipedia.org
no.wikipedia.org
sv.wikipedia.org
www.wikidata.org
www.wikidata.org
web.archive.org
www.imdb.com
www.wikidata.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 41 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 100% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 78 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 76% | Headers should reflect the contents of a site. This site has a 33 % match | |
Links | 28% | Link anchors should to some degree reflect the contents of a site. This site has a 14 % match | |
Image alt tags | 76% | Image alt tags should to some degree reflect the contents of a site. This site has a 27 % match | |
Bold and italic | 18% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 6 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 70% | 70 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 100% | An ideal page contains between 400 and 600 words.This page contains 575 words | |
Server response time | 100% | A fast server speeds up a website. This server responds 13.1% faster then average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 39 inline style declarations ( <a style="color:green">) with a size of 1333 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
10 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/5/50/kristin_lavransdatter_film.jpg/220px-kristin_lavransdatter_film.jpg height: 309 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/8/8a/oojs_ui_icon_edit-ltr-progressive.svg/10px-oojs_ui_icon_edit-ltr-progressive.svg.png height: 10 width: 10 description: edit this at wikidata |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/f/fc/drama_film_icon.svg/30px-drama_film_icon.svg.png height: 30 width: 30 description: stub icon |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/3/3e/norway_film_clapperboard.svg/35px-norway_film_clapperboard.svg.png height: 35 width: 35 description: stub icon |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/static/images/footer/poweredby_mediawiki.svg height: 29 width: 84 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!