en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 64% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/lake_view_cemetery_(seattle)
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be seattle
Focus keyword
Short and long tail
Short Tail Keywords seattle cemetery view |
long Tail Keywords (2 words) capitol hill lake view view cemetery bruce lee martial artist |
long Tail Keywords (3 words) lake view cemetery move to sidebar view cemetery seattle capitol hill neighborhood 1221855w 4763389n 12231528w nisei war memorial 4763389n 12231528w 4763389 |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/lake_view_cemetery_(seattle) page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
lake view cemetery seattle wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia map edit wikidata wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/lake_view_cemetery_(seattle)
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/lake_view_cemetery_(seattle)
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
cemetery found in path !
lake found in path !
seattle found in path !
view found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlelakeviewcemeteryseattleoldid1242144020
page information
printable version
|
wiki coordinates
seattle
find a grave
cemetery
washington
capitol hill
volunteer
masonic
lake washington
princess angeline
chief seattle
walter b beals
beriah brown
libbie beach brown
gottlieb burian
burien washington
denny party
carson boren
arthur a denny
george frye
david swinson doc maynard
thomas mercer
tudor ganea
jesse glover
william grose
granville o haller
thaddeus hanford
jeff heath
major league baseball
horace chapin henry
don a jones
rear admiral
national oceanic and atmospheric administration commissioned officer corps
united states coast and geodetic survey
national ocean service
john leary
bruce lee
brandon lee
kurt cobain
denise levertov
william harvey lillard
chiropractic
eugene mcallaster
duwamish
john w nordstrom
nordstrom
guy carleton phinney
a w piper
socialist
seattle city council
pipers creek
piper orchard
guendolen plestcheeff
preservationist
steve pool
renton washington
john saxon
edmund a smith
john tester
george tsutakawa
northwest school
cordelia wilson
henry yesler
nisei
japanese american
confederate
united daughters of the confederacy
george floyd protests
grand army of the republic cemetery
the oregonian
time
the seattle times
historylink
kirotv
isbn
moon publications
fodors
lonely planet
capitol hill seattle
bullitt center
capitol hill arts center
capitol hill branch library
chophouse row
colman automotive
pierre p ferry house
first church of christ scientist
first methodist protestant church
kellyspringfield motor truck co
melrose market
oddfellows hall
pike motorworks
pride place
roy vue
seattle asian art museum
st josephs church
st marks episcopal cathedral
starbucks reserve roastery
teal building
volunteer park conservatory
ward house
35th north
analog coffee
annapurna cafe
artusi
bakery nouveau
bauhaus strong coffee
big marios pizza
bok a bok
capitol cider
cc attles
comet tavern
cone steiner
the confectional
cuff complex
d la santa
deluxe bar and grill
dingfelders
dinos tomato pie
dont yell at me
dough joy
drip tea
espresso vivace
frankie jos
fuel coffee books
general porpoise
ghost note coffee
glos
half and half doughnut co
hello robin
hot mamas pizza
julias on broadway
kedai makan
kitanda
la josies
life on mars
lil woodys
lindas tavern
lost lake
ltd edition sushi
madison pub
momiji
monsoon
mt joy
nacho borracho
neighbours nightclub
oddfellows
ooink
osteria la spiga
overcast coffee
pony
poquitos
queer bar
quinns pub
rachels ginger beer
raygun lounge
regent
rione xiii
rubinstein bagels
sams tavern
seattle coffee works
seattle eagle
serious pie
shikorina
single shot
spice waala
spinasse
stateside
sweet alchemy
taku
tamari bar
taurus ox
tavern law
tavolta
tin table
unicorn
union seattle
via tribunali
victrola coffee roasters
volunteer park cafe pantry
wall of sound
westmans bagel coffee
the wildrose
the woods
zions gate records
barrio
ben esthers vegan jewish deli
big little news
blotto
boca
coastal kitchen
dacha diner
harvard exit theatre
omega ouzeri
poppy
purr cocktail lounge
r place
rancho bravo tacos
ristorante machiavelli
sitka and spruce
broadway high school
seattle academy of arts and sciences
seattle central college
blaine street stairs
broadway district
harvardbelmont landmark district
howe street stairs
cal anderson
i5 colonnade
interlaken
louisa boren
plymouth pillars
summit slope
tashkent
aids memorial pathway
black lives matter street mural
black sun
jet kiss
thomas burke monument
untitled lee kelly 1975
waterworks
wind cradle
jimi hendrix
william h seward
broadway
capitol hill station
denny way
east republican street stairway
first hill streetcar
madison street
rapidride g line
trolleybuses
capitol hill mystery soda machine
capitol hill occupied protest
|
Links to external pages
Outloing links
ko.wikipedia.org
nl.wikipedia.org
www.wikidata.org
www.wikidata.org
commons.wikimedia.org
geohack.toolforge.org
www.google.com
www.google.com
scholar.google.com
www.jstor.org
www.oregonlive.com
books.google.com
www.nvcfoundation.org
books.google.com
books.google.com
www.archive.org
books.google.com
commons.wikimedia.org
www.wikidata.org
www.viaf.org
id.loc.gov
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 41 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 271 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 100% | Headers should reflect the contents of a site. This site has a 54 % match | |
Links | 10% | Link anchors should to some degree reflect the contents of a site. This site has a 5 % match | |
Image alt tags | 56% | Image alt tags should to some degree reflect the contents of a site. This site has a 20 % match | |
Bold and italic | 51% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 17 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 43% | 42.857142857143 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 1690 words | |
Server response time | 100% | A fast server speeds up a website. This server responds 1% faster then average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 57 inline style declarations ( <a style="color:green">) with a size of 1032 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
14 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/99/question_book-new.svg/50px-question_book-new.svg.png height: 39 width: 50 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/f/fe/seattle_-_nisei_war_memorial_02.jpg/250px-seattle_-_nisei_war_memorial_02.jpg height: 333 width: 250 description: no alt description found |
|
https://maps.wikimedia.org/img/osm-intl,13,a,a,250x200.png?lang=en&domain=en.wikipedia.org&title=lake_view_cemetery_%28seattle%29&revid=1242144020&groups=_afd06e83213b11a466078c935e44305f6f40c701 height: 200 width: 250 description: map |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/6/60/bruce_brandon.jpg/220px-bruce_brandon.jpg height: 165 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/4/4d/seattle_-_lake_view_cemetery_-_confederate_veterans_memorial.jpg/170px-seattle_-_lake_view_cemetery_-_confederate_veterans_memorial.jpg height: 218 width: 170 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/4a/commons-logo.svg/30px-commons-logo.svg.png height: 40 width: 30 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/96/symbol_category_class.svg/16px-symbol_category_class.svg.png height: 16 width: 16 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/8/8a/oojs_ui_icon_edit-ltr-progressive.svg/10px-oojs_ui_icon_edit-ltr-progressive.svg.png height: 10 width: 10 description: edit this at wikidata |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/w/resources/assets/poweredby_mediawiki.svg height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!