en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 55% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/narayanaswamy_srinivasan
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be srinivasan
Focus keyword
Short and long tail
Short Tail Keywords srinivasan october retrieved |
long Tail Keywords (2 words) october 2016 2016 retrieved 24 october retrieved 24 narayanaswamy srinivasan |
long Tail Keywords (3 words) retrieved 24 october 24 october 2016 names authors list 2016 retrieved 24 multiple names authors maint multiple names cs1 maint multiple |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/narayanaswamy_srinivasan page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
narayanaswamy srinivasan wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia flag icon edit wikidata wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/narayanaswamy_srinivasan
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/narayanaswamy_srinivasan
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
narayanaswamy found in path !
srinivasan found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlenarayanaswamysrinivasanoldid1227946969
page information
printable version
|
wiki chennai
tamil nadu
indian
university of madras
indian institute of science
computational genomics
protein structure
shanti swarup bhatnagar prize
molecular biophysics
university of la runion
birkbeck college
manchester university
university of nantes
indian academy of sciences
national academy of sciences india
department of biotechnology
department of science and technology
council of scientific and industrial research
shanti swarup bhatnagar
april fools day
padmanabhan balaram
padma bhushan
tom blundell
ludwig institute for cancer research
university of cambridge
wellcome trust
bioinformatics
google scholar
researchgate
nucleotide sequences
international society for computational biology
f1000 research
bioinformatics
plos one
resonance
biology direct
scientific reports
plos computational biology
journal of biosciences
current opinions in structural biology
pmid
bibcode
s2cid
jstor
nucleic acid sequence
punjab university chandigarh
university of kerala
university of hyderabad
delhi university
madurai kamaraj university
jadavpur university
anna university
shanmugha arts science technology research academy
vellore institute of technology
kuvempu university
macquarie university
jawaharlal nehru university
isbn
keystone symposia
biological science
toppur seethapathy sadasivan
m s swaminathan
bimal kumar bachhawat
jagannath ganguly
dilbagh singh athwal
c v subramanian
hari krishan jain
neelamraju ganga prasada rao
arun kumar sharma
tathamangalam ananthanarayanan venkitasubramanian
madhu sudan kanungo
narayana balakrishnan nair
birendra bijoy biswas
satish chandra maheshwari
bhyravabhotla radhakrishna murty
sardul singh guraya
john barnabas
obaid siddiqi
archana sharma
guru prakash dutta
kishan singh
t c anand kumar
v sasisekharan
amar nath bhaduri
m k chandrashekaran
asis datta
jamuna sharan singh
prafullachandra vishnu sane
sushil kumar
sunil kumar podder
ramamirtha jayaraman
govindarajan padmanabhan
thavamani jegajothivel pandian
k r k easwaran
chhitar mal gupta
m vijayan
madhav gadgil
avadhesha surolia
sudhir kumar sopory
bhabatarak bhattacharyya
m r s rao
subhash chandra lakhotia
manju ray
samir k brahmachari
virendra nath pandey
srinivas kishanrao
kuppamuthu dharmalingam
dipankar chatterji
raghavendra gadagkar
m r n murthy
ramakrishnan nagaraj
alok bhattacharya
seyed e hasnain
kalappa muniyappa
ghanshyam swarup
vishweshwaraiah prakash
jayaraman gowrishankar
kanury venkata subba rao
k vijayraghavan
debi prasad sarkar
siddhartha roy
valakunja nagaraja
dinakar mashnu salunke
jayant b udgaonkar
umesh varshney
raghavan varadarajan
amitabha mukhopadhyay
satyajit mayor
gopal kundu
ramesh venkata sonti
tapas kumar kundu
shekhar c mande
vinod bhakuni
rajesh sudhir gokhale
upinder singh bhalla
gajendra pal singh raghava
l s shashidhara
amitabh joshi
bhaskar saha
sanjeev galande
shubha tole
amit prakash sharma
rajan sankaranarayanan
shantanu chowdhury
suman kumar dhar
sathees chukkurumbal raghavan
roop mallik
balasubramanian gopal
rajeev kumar varshney
suvendra nath bhattacharyya
rishikesh narayanan
deepak t nair
sanjeev das
ganesh nagaraju
thomas j pucadyil
kayarat saikrishnan
subhadeep chatterjee
vatsala thirumalai
amit singh
arun kumar shukla
ashwani kumar
maddika subba reddy
govindarajan padmanaban
t r govindachari
kuppuswamy nagarajan
dorairajan balasubramanian
paramasivam natarajan
srinivasan chandrasekaran
narayanasami sathyamurthy
thirumalachari ramasami
mariappan periasamy
narayanan chandrakumar
murali sastry
narayanaswamy jayaraman
govindasamy mugesh
kunchithapadam gopalan
rengaswamy ramesh
tanjore ramachandra anantharaman
vaidyeswaran rajaraman
paul ratnasamy
ramarathnam narasimhan
viswanathan kumaran
b s murty
g k ananthasuresh
shanthi pavan
c s seshadri
kalyanapuram rangachari parthasarathy
e m v krishnamurthy
sundararaman ramanan
srinivasacharya raghavan
ramaiyengar sridharan
rajagopalan parthasarathy
thiruvenkatachari parthasarathy
raman parimala
ramachandran balasubramanian
annamalai ramanathan
vaikalathur shankar sunder
trivandrum ramakrishnan ramadas
subhashis nag
sundaram thangavelu
vikraman balaji
subramanian kalyanaraman
vijayalakshmi ravindranath
kariamanickam srinivasa krishnan
g n ramachandran
sivaraj ramaseshan
ramanuja vijayaraghavan
e s raja gopal
n s satya murthy
ramanujan srinivasan
tiruppattur venkatachalamurti ramakrishnan
muthusamy lakshmanan
ganapathy baskaran
rajiah simon
e v sampathkumaran
vijay balakrishna shenoy
birendra nath mallick
akhilesh kumar tyagi
p pardha saradhi
p ananda kumar
k p mohanakumar
madhu dikshit
anand kumar bachhawat
nagendra kumar singh
ram rajasekharan
pradip k chakraborti
akhil chandra banerjea
m radhakrishna pillai
mohammad islam khan
rakesh kumar jain
anil grover
santanu bhattacharya
joyoti basu
rakesh aggarwal
usha vijayaraghavan
trilochan mohapatra
sudhanshu vrati
soniya nityanand
chinmoy sankar dey
jyoti prakash tamang
banwari lal
k sekar
amita aggarwal
geeta kashyap vemuganti
rajendra prasad roy
sudip chattopadhyay
apurva sarin
dulal panda
saumitra das
g pradeep kumar
ajay kumar parida
pramod p wangikar
g taru sharma
javed n agrewala
kumaravel somasundaram
t r sharma
snehasikta swarnakar
srinivasan ramachandran
r sowdhamini
ranjan sen
owais mohammad
g dhinakar raj
utpal shashikant tatu
nihar ranjan jana
r sankararamakrishnan
anuranjan anand
samit kumar nandi
s ganesh
nagasuma chandra
sangita mukhopadhyay
pushkar sharma
mohan r wani
garikapati narahari sastry
ashok m raichur
balaji prakash
k narayanaswamy balaji
debasisa mohanty
sunil kumar manna
c kesavadas
|
Links to external pages
Outloing links
www.wikidata.org
www.doi.org
pubmed.ncbi.nlm.nih.gov
www.ncbi.nlm.nih.gov
www.doi.org
www.ncbi.nlm.nih.gov
pubmed.ncbi.nlm.nih.gov
ui.adsabs.harvard.edu
www.doi.org
pubmed.ncbi.nlm.nih.gov
api.semanticscholar.org
www.ncbi.nlm.nih.gov
www.jstor.org
www.ncbi.nlm.nih.gov
pubmed.ncbi.nlm.nih.gov
www.doi.org
pubmed.ncbi.nlm.nih.gov
api.semanticscholar.org
www.ncbi.nlm.nih.gov
www.ncbi.nlm.nih.gov
pubmed.ncbi.nlm.nih.gov
www.ncbi.nlm.nih.gov
www.ncbi.nlm.nih.gov
pubmed.ncbi.nlm.nih.gov
patents.google.com
ssbprize.gov.in
www.ias.ac.in
www.nasi.org.in
web.archive.org
ssbprize.gov.in
www.f1000.com
oasis.csir.res.in
pauling.mbu.iisc.ac.in
web.archive.org
scholar.google.com
www.researchgate.net
www.google.com
www.researchgate.net
books.google.com
www.jubilantbiosys.com
iisc.academia.edu
www.wikidata.org
www.viaf.org
scholar.google.com
www.idref.fr
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 87% | A title should reflect the contents of a site. This site has a 67 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 37 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 376 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 30% | Headers should reflect the contents of a site. This site has a 13 % match | |
Links | 10% | Link anchors should to some degree reflect the contents of a site. This site has a 5 % match | |
Image alt tags | 25% | Image alt tags should to some degree reflect the contents of a site. This site has a 9 % match | |
Bold and italic | 45% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 15 % match | |
Html ratio | 40% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 78% | 77.777777777778 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 2586 words | |
Server response time | 30% | A slow server slows down a website. This server responds 363.02% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 30% | There are no important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 103 inline style declarations ( <a style="color:green">) with a size of 1744 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
9 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/4/41/flag_of_india.svg/32px-flag_of_india.svg.png height: 21 width: 32 description: flag |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/2/2d/issoria_lathonia.jpg/32px-issoria_lathonia.jpg height: 23 width: 32 description: icon |
|
https://upload.wikimedia.org/wikipedia/en/thumb/8/8a/oojs_ui_icon_edit-ltr-progressive.svg/10px-oojs_ui_icon_edit-ltr-progressive.svg.png height: 10 width: 10 description: edit this at wikidata |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/w/resources/assets/poweredby_mediawiki.svg height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!