en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 65% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/navaminda_kasatriyadhiraj_royal_thai_air_force_academy
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be university
Focus keyword
Short and long tail
Short Tail Keywords university royal air |
long Tail Keywords (2 words) royal thai air force thai air kasatriyadhiraj royal force academy |
long Tail Keywords (3 words) royal thai air air force academy thai air force navaminda kasatriyadhiraj royal royal air force university of technology kasatriyadhiraj royal air |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/navaminda_kasatriyadhiraj_royal_thai_air_force_academy page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
navaminda kasatriyadhiraj royal thai air force academy wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia thailand wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/navaminda_kasatriyadhiraj_royal_thai_air_force_academy
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/navaminda_kasatriyadhiraj_royal_thai_air_force_academy
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
academy found in path !
air found in path !
force found in path !
kasatriyadhiraj found in path !
navaminda found in path !
royal found in path !
thai found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlenavamindakasatriyadhirajroyalthaiairforceacademyoldid1237130759
page information
printable version
3rd infantry division
6th infantry division
11th infantry division
1st cavalry division
2nd cavalry division kings guard
3rd cavalry division
1st development division
2nd development division
3rd development division
4th development division
royal thai police cadet academy
royal thai army nursing college
royal thai navy nursing college
royal thai air force nursing college
thailand national sports university
bunditpatanasilpa institute
chitralada technology institute
princess galyani vadhana institute of music
srisavarindhira thai red cross institute of nursing
amata university
asian institute of hospitality management
|
wiki coordinates
air force academies
fuen ronnaphagrad ritthakhanee
saraburi province
thai
military academy
royal thai air force
f16 fighting falcon
f5e tiger ii
f86 sabre
don muang royal thai air force base
king bhumibol adulyadej
muak lek district
ct4 training plane
bachelor of engineering
electrical engineering
civil engineering
industrial engineering
aviation management
mechanical engineering
aerospace engineering
bachelor of science
computer science
chulachomklao royal military academy
royal thai naval academy
armed forces academies preparatory school
national defence college of thailand
armed forces
highest commander of the armed forces
royal thai army
royal thai navy
ministry of defence
minister of defence kalahom
royal thai armed forces hq
chief of defence forces
chief of the army
chief of the navy
chief of the air force
kings guard
royal thai marine corps
air and coastal defense command
royal thai air force security force command
territorial defense student
division
1st infantry division kings guard
2nd infantry division queen sirikits guard
4th infantry division
5th infantry division
7th infantry division
9th infantry division
15th infantry division
special forces
royal thai army special warfare command
royal thai army ranger
special operation battalion 90th task force
naval special warfare command
rtmc reconnaissance battalion
rtaf special operations regiment
thahan phran
border patrol police
police
volunteer defense corps
ministry of interior
phramongkutklao college of medicine
history of the military
military flags
ranks of the armed forces
military courts
thai royal guards parade
order of rama
lerdrit
universities and colleges in thailand
kalasin university
mahasarakham university
nakhon phanom university
naresuan university
princess of naradhiwas university
ramkhamhaeng university
sukhothai thammathirat open university
ubon ratchathani university
rajabhat universities
chandrakasem rajabhat university
chiang mai rajabhat university
kanchanaburi rajabhat university
phuket rajabhat university
pibulsongkram rajabhat university
songkhla rajabhat university
udon thani rajabhat university
uttaradit rajabhat university
rajamangala university of technology
rajamangala university of technology lanna
rajamangala university of technology srivijaya
rajamangala university of technology thanyaburi
pathumwan institute of technology
praboromarajchanok institute
burapha university
chiang mai university
chulalongkorn university
kasetsart university
khon kaen university
king mongkuts university of technology north bangkok
king mongkuts university of technology thonburi
mae fah luang university
maejo university
mahachulalongkornrajavidyalaya university
mahamakut buddhist university
mahidol university
navamindradhiraj university
university of phayao
prince of songkla university
silpakorn university
srinakharinwirot university
suranaree university of technology
thaksin university
thammasat university
walailak university
chulabhorn graduate institute
king mongkuts institute of technology ladkrabang
national institute of development administration
hrh princess chulabhorn college of medical science
asiapacific international university
assumption university
bangkok university
bangkokthonburi university
chaopraya university
dhurakij pundit university
far eastern university
hatyai
huachiew chalermprakiet university
international buddhist college
kasem bundit university
krirk university
lumnamping college
mahanakorn university of technology
nation university
north chiang mai university
pathumthani university
payap university
rangsit university
saint johns group of schools and university
shinawatra university
siam university
sripatum university
stamford international university
tapee college
university of the thai chamber of commerce
thonburi university
vongchavalitkul university
webster university thailand
thainichi institute of technology
dusit thani college
thongsuk college
asian institute of technology
chulabhorn research institute
joint graduate school of energy and environment
mahapanya vidayalai
thailand graduate institute of science and technology
thailand advanced institute of science and technology
cmkl university
education in thailand
list of medical schools in thailand
egypt
south africa
brazil
united states
bangladesh
peoples republic of china
indonesia
jordan
south korea
pakistan
sri lanka
turkey
finland
france
greece
italy
norway
poland
portugal
united kingdom
australia
new zealand
|
Links to external pages
Outloing links
www.wikidata.org
www.wikidata.org
commons.wikimedia.org
geohack.toolforge.org
www.rtafaqa.org
nkrafa.ac.th
foundation.wikimedia.org
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 67 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 265 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 7 folders above or in the first level of navigation. | |
Headings | 100% | Headers should reflect the contents of a site. This site has a 59 % match | |
Links | 18% | Link anchors should to some degree reflect the contents of a site. This site has a 9 % match | |
Image alt tags | 70% | Image alt tags should to some degree reflect the contents of a site. This site has a 25 % match | |
Bold and italic | 90% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 30 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 29% | 29.411764705882 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 1698 words | |
Server response time | 100% | A fast server speeds up a website. This server responds 84.82% faster then average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 131 inline style declarations ( <a style="color:green">) with a size of 2838 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
16 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/b/b4/ambox_important.svg/40px-ambox_important.svg.png height: 40 width: 40 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/99/question_book-new.svg/50px-question_book-new.svg.png height: 39 width: 50 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/c/c7/seal_of_rtafc%2c_approved_at_2016-08-08%2c_published_in_rg_at_2016-08-24.jpg/220px-seal_of_rtafc%2c_approved_at_2016-08-08%2c_published_in_rg_at_2016-08-24.jpg height: 177 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/7/7b/fighters_on_a_stick_%28rtaf_academy%29.jpg/220px-fighters_on_a_stick_%28rtaf_academy%29.jpg height: 310 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/a/ac/unit_colours_of_the_air_cadet_regiment%2c_king%27s_guard%2c_rtaf.jpg/220px-unit_colours_of_the_air_cadet_regiment%2c_king%27s_guard%2c_rtaf.jpg height: 293 width: 220 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/a/a9/flag_of_thailand.svg/23px-flag_of_thailand.svg.png height: 15 width: 23 description: thailand |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/f/f8/emblem_of_the_royal_thai_army.svg/30px-emblem_of_the_royal_thai_army.svg.png height: 63 width: 30 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/b/bf/emblem_of_the_royal_thai_navy.svg/30px-emblem_of_the_royal_thai_navy.svg.png height: 62 width: 30 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/a/a8/emblem_of_the_royal_thai_air_force.svg/65px-emblem_of_the_royal_thai_air_force.svg.png height: 51 width: 65 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/4/4b/emblem_of_the_ministry_of_defence_of_thailand.svg/150px-emblem_of_the_ministry_of_defence_of_thailand.svg.png height: 134 width: 150 description: no alt description found |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/w/resources/assets/poweredby_mediawiki.svg height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!