en.wikipedia.org website review
![](/include/images/menno/screenl1.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/screenl2.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/highlight.png)
Improve your SEO :: free trial!
en.wikipedia.org is 66% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/parlakimedi_light_railway
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be line
Focus keyword
Short and long tail
Short Tail Keywords line railway section |
long Tail Keywords (2 words) light railway branch line sidebar hide main line parlakimedi light |
long Tail Keywords (3 words) move to sidebar conversion to broad gajapati narayan dev parlakimedi light railway chandra gajapati narayan krushna chandra gajapati needing additional references |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/parlakimedi_light_railway page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
parlakimedi light railway wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/parlakimedi_light_railway
Mobile rendering
![](/include/images/menno/screenl1.png)
![](/include/images/menno/screenl2.png)
![](/include/images/menno/highlight.png)
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
![](/include/images/icons/loader.gif)
![](/include/images/icons/loader.gif)
Marketing / lead generation for en.wikipedia.org/wiki/parlakimedi_light_railway
Social Media
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
light found in path !
parlakimedi found in path !
railway found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Favicon icon found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Robots.txt found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Sitemap found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitleparlakimedilightrailwayoldid1216690029
page information
printable version
raxaulsagauli line
|
wiki railways
paralakhemundi
india
naupada
gunupur
odisha
andhra pradesh
gajapati
paralakhemundi estate
narrow gauge
gcie
krushna chandra gajapati
bengalnagpur railway
064
barauniguwahati line
grand chord
howrahchennai main line
howrahgayadelhi line
howrahnagpurmumbai line
howrahnew delhi main line
howrahnew jalpaiguri line
howrahprayagrajmumbai line
sahibganj loop
asansolgaya section
asansolpatna section
asansoltatanagarkharagpur line
baraunigorakhpur raxaul and jainagar lines
barkakanason nagar line
barsoinew farakka section
barsoiradhikapur branch line
dumkabhagalpur line
gayapandit deen dayal upadhyaya junction section
hatiarourkela line
jasidihdumkarampurhat line
jharsugudavizianagaram line
katiharsiliguri line
kharagpurpuri line
khurda roadvisakhapatnam section
kothavalasakirandul line
new jalpaigurialipurduarsamuktala road line
new jalpaigurinew bongaigaon section
tatanagarbilaspur section
bakhtiyarpurtilaiya line
baraunikatihar section
baraunisamastipur section
fatuhatilaiya line
gayakiul line
mokamabarauni section
muzaffarpurgorakhpur line via hajipur raxaul and sitamarhi
muzaffarpurgorakhpur main line
muzaffarpursitamarhi section
muzaffarpurhajipur section
narkatiaganjbhikhna thori branch line
neoradaniyawanbihar sharifsheikhpura line
patnagaya line
patnamughalsarai section
patnasonepurhajipur section
samastipurmuzaffarpur section
barkakananetaji scbose gomoh line
barkakanamurichandil line
dhanbadchandrapura line
railways in jharia coalfield
kodermahazaribaghbarkakanaranchi line
madhupurgiridihkoderma line
netaji scbose gomohhatia line
khurda roadbolangir line
cuttacksambalpur line
ahmadpurkatwa line
alipurduarbamanhat branch line
andalsainthia branch line
andalsitarampur loop line
bandelkatwa line
bankuramasagram line
bardhamanasansol section
bardhamankatwa line
barharwaazimganjkatwa loop
darjeeling himalayan railway
eklakhibalurghat branch line
haldibarinew jalpaiguri line
howrahbarddhaman main line
howrahbardhaman chord
howrahkharagpur line
kharagpurbankuraadra line
new malchangrabandhanew cooch behar line
santragachiamta branch line
sealdah main and north section
calcutta chord link line
kolkata circular railway
sealdahbangaon line
sealdahranaghatgede line
ranaghatkrishnanagar citylalgola line
sealdah south section
sheoraphulibishnupur branch line
kolkata metro
kolkata suburban railway
kolkata monorail
patna monorail
ahmedpurkatwa railway
bankuradamodar railway
barasatbasirhat light railway
burdwankatwa railway
bakhtiarpurbihar light railway
futwahislampur light railway
bengal provincial railway
east coast state railway
kalighat falta railway
mayurbhanj state railway
dehri rohtas light railway
patnadigha ghat line
zones divisions
eastern
asansol
howrah
malda
sealdah
east central
danapur
dhanbad
pandit deen dayal upadhyaya
samastipur
sonpur
east coast
sambalpur
khurda road
waltair
north eastern
varanasi
northeast frontier
katihar
alipurduar
south eastern
chakradharpur
kharagpur
ranchi
chittaranjan locomotive works
braithwaite burn jessop construction company
braithwaite co
burn standard company limited
bharat wagon and engineering
carriage repair workshop harnaut
haldibari
chilahati
singhabad
rohanpur
radhikapur
biral
darshana
petrapole
benapole
mahisasan
changrabandha
burimari
new gitaldaha
mogalhat
raxaul junction
bairgania
jaynagar
jogbani
laukaha bazar
thakurganj
east indian railway company
bengal nagpur railway
indian branch railway company
indian railways
martins light railways
bholu mascot
suburban rail in india
|
Links to external pages
Outloing links
www.wikidata.org
www.google.com
www.google.com
www.google.com
scholar.google.com
www.jstor.org
www.orissalinks.com
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 100% | A title should reflect the contents of a site. This site has a 100 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 38 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 50% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 197 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 6 folders above or in the first level of navigation. | |
Headings | 100% | Headers should reflect the contents of a site. This site has a 44 % match | |
Links | 18% | Link anchors should to some degree reflect the contents of a site. This site has a 9 % match | |
Image alt tags | 39% | Image alt tags should to some degree reflect the contents of a site. This site has a 14 % match | |
Bold and italic | 72% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 24 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 57% | 57.142857142857 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 55% | An ideal page contains between 400 and 600 words.This page contains 1096 words | |
Server response time | 30% | A slow server slows down a website. This server responds 221.6% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 101 inline style declarations ( <a style="color:green">) with a size of 2339 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
7 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/99/question_book-new.svg/50px-question_book-new.svg.png height: 39 width: 50 description: no alt description found |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/static/images/footer/poweredby_mediawiki.svg height: 29 width: 84 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!