en.wikipedia.org website review
Improve your SEO :: free trial!
en.wikipedia.org is 57% geoptimaliseerd!
SEO Keyword summary for en.wikipedia.org/wiki/syrian_civil_war_ceasefires
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be offensive
Focus keyword
Short and long tail
Short Tail Keywords offensive syria syrian |
long Tail Keywords (2 words) february 2016 2016 archived 2016 retrieved september 2016 retrieved 2 |
long Tail Keywords (3 words) february 2016 archived february 2016 retrieved syrian civil war 2 january 2020 retrieved 2 january rif dimashq offensive 2019 retrieved 2 |
en.wikipedia.org On-Page SEO Scan
Descriptive Elements
The <head> element of a en.wikipedia.org/wiki/syrian_civil_war_ceasefires page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
syrian civil war ceasefires wikipedia
Meta description
Meta description legth
Meta description SEO
No meta relevance in the description detected !
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wikipedia free encyclopedia wikimedia foundation powered mediawiki
Mobile SEO en.wikipedia.org/wiki/syrian_civil_war_ceasefires
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for en.wikipedia.org/wiki/syrian_civil_war_ceasefires
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
16 characters long
Domain name SEO Impact
Path name
ceasefire found in path !
civil found in path !
syria found in path !
syrian found in path !
war found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
statistics
|
en.m.wikipedia.org |
en.wikipedia.org wikimedia foundation inc
|
w httpsenwikipediaorgwindexphptitlesyriancivilwarceasefiresoldid1245433194
page information
printable version
|
wiki syrian civil war
peace process
arab league
arab league monitors
churkin peace plan
kofi annan peace plan
geneva i
lakhdar brahimi peace plan
usrussia peace proposals
geneva ii conference
staffan de mistura peace plan
2015 zabadani ceasefire agreement
vienna talks
geneva iii
geneva iv
idlib demilitarization
first northern syria demilitarization deal
second northern syria demilitarization deal
syrian constitutional committee
syrianturkish normalization
bashar assad presidentship
baathist government
interim government
secularism in syria
human rights
refugees
un humanitarian aid
sectarianism
control of oil
water supply
battle of aleppo
siege of madaya
peace envoy for syria
united nations
un office for coordination of humanitarian affairs
federalization of syria
destruction of chemical weapons
constitution
constitution of syria
constitution of syrian opposition
constitution of rojava
safe zones
friends of syria group
free syrian university
raqqa is being slaughtered silently
syrian civil war
international syria support group
united nations security council
resolution 2268
2016 geneva talks
islamic state of iraq and the levant
alnusra front
geneva syria peace talks
offensive operations
aleppo governorate
turkey
saudi arabia
united arab emirates
sergey lavrov
muscat
oman
syrias border with turkey
walid muallem
sdf militias
afrin
deir jamal
menagh military airbase
campaign of shelling
azaz
vladimir putin
its military
khmeimim airbase
port at tartus
irgc
ground forces of islamic republic of iran army
army commandos
regular iranian army
iraniraq war
palmyra offensive mar
alrai
northern aleppo offensive marjun
september deir ezzor air raid
syrian arab red crescent
astana
kazakhstan
national coalition for syrian revolutionary and opposition forces
sham legion
ahrar alsham
jaysh alislam
free idlib army
levant front
jabhat ahl alsham
army of mujahideen
army of victory
hama governorate
idlib governorate
wadi barada offensive
fresh rebel offensive in daraa
deescalation
homs governorate
ghouta
jordansyria border
trump administration
heather nauert
s2cid
wayback machine
the atlantic
karam zeina
fars news agency
the long war journal
reuters
issn
us department of state
syria
rojava
timeline
syrian government reactions
belligerents
first interrebel conflict
spillover
cities and towns
sectarianism and minorities
syrian desert campaign december 2017present
casualties
refugees
humanitarian aid
human rights violations
syrian revolution
early insurgency phase
20122013 escalation
international reactions
foreign involvement
russian involvement
military intervention
turkish occupation of northern syria
idlib demilitarization 2018present
us intervention
2023 attacks on us bases in iraq and syria
kurdish area in syria
rojava conflict
russianturkish agreement on syria
relations between syrian government and kurdish groups in syria
1963 coup
1966 coup
corrective movement
islamist uprising
latakia protests
damascus spring
qamishli riots
syrian occupation of lebanon
damascus declaration
human rights in syria
2010s in syria political history
syrian revolution
hamza alkhateeb
siege of daraa
siege of baniyas
may talkalakh siege
siege of rastan and talbiseh
june jisr ashshughur operation
siege of hama
siege of homs
jabal alzawiya operation
siege of latakia
deir ezzor clashes 20112014
rif dimashq clashes nov 2011mar 2012
battle of zabadani
battle of douma
daraa governorate clashes
battle of rastan
shayrat and tiyas airbase ambush
idlib governorate clashes
december jabal alzawiya massacres
january almidan bombing
battle of rastan
first battle of idlib
battle of alqusayr
idlib governorate operation apr
battle of taftanaz
may battle of rastan
houla massacre
battle of alhaffah
alqubeir massacre
battle of tremseh
battle of damascus
18 july 2012 damascus bombing
battle of anadan
siege of base 46
alhasakah governorate campaign 20122013
rif dimashq offensive augoct
darayya massacre
battle of khirbet aljoz
battle of maarrat alnuman
first siege of wadi deif
battle of harem
rif dimashq offensive nov 2012feb 2013
battle of darayya
aqrab massacre
hama offensive
halfaya massacre
quneitra governorate clashes
talbiseh bakery massacre
battle of safira
battle of shadadeh
damascus offensive
raqqa campaign 20122013
battle of raqqa mar
daraa offensive
rif dimashq offensive maraug
battle of jdaidet alfadl
ghouta chemical attack
alqusayr offensive
battle of alqusayr
bayda and baniyas massacres
hama offensive
hatla massacre
khan alassal chemical attack
khan alassal massacre
adra massacre
battle of ras alayn
battle of tell abyad
rif dimashq offensive sepnov
aleppo offensive octdec
battle of alyaarubiyah
battle of tell hamis and tell brak decjan
battle of markada
deir ezzor offensive
battle of morek
daraa offensive febmay
maan massacre
alotaiba ambush
idlib offensive
battle of hosn
latakia offensive
battle of almalihah
kafr zita chemical attack
second siege of wadi deif
qalamoun offensive junaug
battle of arsal
first battle of the shaer gas field
eastern syria offensive
battle of tabqa airbase
northern aleppo offensive febjul
hama offensive
quneitra offensive
rif dimashq offensive augnov
siege of koban
homs school bombing
daraa offensive oct
alsafira offensive
idlib raid
second interrebel conflict
second battle of the shaer gas field
battle of alshaykh maskin
deir ezzor offensive dec
air force an26 crash
daraa offensive jan
southern syria offensive
eastern alhasakah offensive
battle of sarrin marapr
battle of sarrin junjul
battle of bosra
idlib offensive
second battle of idlib
battle of nasib border crossing
battle of yarmouk camp
western alhasakah offensive
palmyra offensive may
qamishli bombings
tell abyad offensive
koban massacre
quneitra offensive jun
palmyra offensive julaug
rif dimashq offensive sep
northwestern syria offensive octnov
aleppo offensive octdec
alhawl offensive
homs offensive novdec
east aleppo offensive 20152016
20152016 latakia offensive
tishrin dam offensive
russian sukhoi su24 shootdown
second battle of alshaykh maskin
deir ezzor offensive jan
february sayyidah zaynab bombings
northern aleppo offensive feb
ithriyahraqqa offensive febmar
alshaddadi offensive
february homs bombings
khanasir offensive
battle of tel abyad
battle of maarrat alnuman
battle of qamishli apr
east ghouta interrebel conflict aprmay
rif dimashq offensive aprmay
northern raqqa offensive may
may jableh tartous bombings
ithriyahraqqa offensive jun
rif dimashq offensive junoct
manbij offensive
tokhar massacre
southern aleppo campaign
battle of alrai aug
operation euphrates shield
aleppo summer campaign
western albab offensive sep
5 september bombings
september urum alkubra aid convoy attack
aleppo offensive sepoct
dabiq offensive
western albab offensive octnov
khan alshih offensive octnov
raqqa campaign
battle of albab
aleppo offensive novdec
palmyra offensive dec
wadi barada offensive 20162017
january azaz bombing
desert campaign dec 16apr 17
idlib clashes janmar
deir ezzor offensive janfeb
daraa offensive febjun
southwestern daraa offensive feb
qaboun offensive
palmyra offensive
east aleppo offensive janapr
march damascus bombings
aljinah airstrike
hama offensive marapr
battle of tabqa
khan shaykhun chemical attack
shayrat missile strike
aleppo bombing
april turkish airstrikes
east ghouta interrebel conflict aprmay
desert campaign mayjul
maskanah plains offensive
east hama offensive
battle of raqqa
daraa offensive jun
southern raqqa offensive jun
jobar offensive junaug
quneitra offensive jun
idlib clashes jul
central campaign
qalamoun julaug 2017
deir ezzor offensive sep 17mar 18
hama offensive sep
northwestern campaign oct 17feb 18
turkish military operation in idlib governorate
battle of harasta
eastern campaign sepdec
euphrates crossing offensive
mayadin offensive
battle of deir ezzor sepnov
abu kamal offensive
beit jinn offensive
operation olive branch
battle of khasham
rif dimashq offensive febapr
southern damascus offensive janfeb
syrian liberation fronttahrir alsham conflict
southern damascus offensive mar
douma chemical attack
missile strikes apr
northern homs offensive aprmay
eastern qalamoun offensive apr
southern damascus offensive aprmay
deir ezzor clashes apr
deir ezzor offensive mayjun
assuwayda offensive jun
southern offensive
assuwayda attacks
assuwayda augnov
qamishli clashes sep
missile strikes sep
northern border clashes
idlib interrebel conflict
manbij bombing
battle of baghuz fawqani
isil insurgency in deirezzor
drik prison escape attempt
tell rifaat clashes
northwestern offensive apraug
june bombings
hass refugee camp bombing
missile strikes aug
turkish offensive into northeast
barisha raid
november bombings
israeli missile strikes nov
qah missile strike
northwestern offensive dec 19mar 20
covid19 pandemic
afrin bombing
idlib governorate clashes
kafrtakharim airstrike
ayn issa clashes
deir ezzor ambush
siege of qamishli and alhasakah
missile strikes jan
us airstrike feb
battle of qamishli apr
us airstrike jun
daraa clashes
tahrir alshamjunud alsham conflict
battle of alhasakah
ahrar alshamlevant front clashes
jabal albishr clashes
jarqli airstrikes
northern aleppo clashes oct
operation clawsword
northwest clashes dec
alsukhnah attack
damascus airstrike
hama attack
northern border clashes
israel and golan heights
march 2017 incident
february 2018 incident
may 2018 israeliran incidents
april 2014 iraqi border airstrike
akashat ambush
operation alshabah
april 2014 jordanian border airstrike
spillover in lebanon
lebanese border clashes
battle of sidon
iranian embassy bombing in beirut
north lebanon clashes
december 2011 turkish border clash
2012 turkish f4 phantom shootdown
2012 turkish border clashes
2013 reyhanl car bombings
january 2014 turkish attack in syria
assassination of andrei karlov
russian air force albab incident
2020 balyun airstrikes
operation spring shield
deir ezzor missile strike
politics of syria
arab socialist baath party syria region
syrian social nationalist party
arab socialist movement
syrian communist party
syrian armed forces
syrian resistance
alquds brigade
palestine liberation army
hezbollah involvement
iranian involvement
liwa fatemiyoun
medical facility targeting
wagner group
russiasyriairaniraq coalition
popular mobilization forces
opposition
national coalition
local coordination committees
syrian patriotic group
supreme council of the syrian revolution
national coordination committee for democratic change
syrian revolution general commission
syrian support group
adopt a revolution
syrian national army
free syrian army
national front for liberation
army of glory
authenticity and development front
army of free tribes
revolutionary commando army
muslim brotherhood in syria
grey wolves
jordanian intervention
saudi arabia
autonomous administrationof north and east syria
dfns government
democratic union party
kurdish national council
smaller political parties
peoples protection units
womens protection units
antiterror units
alsanadid forces
army of revolutionaries
sdf military councils
syriac military council
liwa thuwar alraqqa
northern democratic brigade
patriotic union of kurdistan
kurdistan workers party
international freedom battalion
sinjar resistance units
zdxan womens units
islamists
islamic state
military activity of isil
dokumaclar
khalid ibn alwalid army
liwa alaqsa
group of the one and only
liwa dawud
alqaeda
tahrir alsham
turkistan islamic party in syria
caucasus emirate
ajnad alkavkaz
junud almakhdi
malhama tactical
ansar alislam in kurdistan
ammar abdulhamid
ali alabdallah
adnan alaroor
alassad family
bashar
maher
rifaat
rami makhlouf
hafez makhlouf
riad alasaad
anwar albunni
fahd jassem alfreij
suheil alhassan
haitham almaleh
moaz alkhatib
kamal allabwani
tal almallohi
fida alsayed
riad alturk
khaled khoja
ammar alqurabi
suheir atassi
ali sadreddine albayanouni
aref dalila
farid ghadry
burhan ghalioun
razan ghazzawi
ghassan hitto
salim idris
randa kassis
abdul halim khaddam
michel kilo
bassma kodmani
ali habib mahmud
ali mahmoud othman
ibrahim qashoush
dawoud rajiha
yassin alhaj saleh
bouthaina shaaban
abdulbaset sieda
riad seif
fadwa souleimane
mohamad anas haitham soueid
yaser tabbara
razan zaitouneh
rami jarrah
abdurrahman mustafa
fadlallah alhaji
2011 local elections
2012 parliamentary election
2014 presidential election
2015 northern local elections
2016 parliamentary election
2017 northern local elections
2017 northern regional elections
2018 local elections
2020 parliamentary election
2021 presidential election
cities and towns
chemical weapons
damaged heritage sites
international demonstrations and protests
status of the golan heights
un supervision mission
39th g8 summit
un security council resolution 2118
vienna talks
universal jurisdiction trials in germany
exclusive mandate
fourth extraordinary session of the islamic summit conference
international recognition of the syrian national council
syria files
syrian detainee report
syrian media coverage
2015 european migrant crisis
syrian civil war in popular culture
|
Links to external pages
Outloing links
www.wikidata.org
www.wikidata.org
www.zenodo.org
api.semanticscholar.org
web.archive.org
www.bbc.com
web.archive.org
2009-2017.state.gov
web.archive.org
www.reuters.com
www.reuters.com
www.newsru.com
www.sana.sy
news.yahoo.com
en.farsnews.com
www.bbc.co.uk
www.reuters.com
www.theguardian.com
web.archive.org
www.bbc.com
www.astanatimes.com
www.foxnews.com
foundation.wikimedia.org
foundation.wikimedia.org
www.wikimediafoundation.org
SEO Advice for en.wikipedia.org
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 78% | A title should reflect the contents of a site. This site has a 60 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 40 characters long | |
Meta Description | 0% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 0% | The meta description should be between 145 and 160 characters. This meta description is 1 characters long. | |
Meta description relevance | 0% | Meta Description should reflect the contents of a site. This site has a 0 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 718 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 3 level 1 folders and 7 folders above or in the first level of navigation. | |
Headings | 100% | Headers should reflect the contents of a site. This site has a 50 % match | |
Links | 8% | Link anchors should to some degree reflect the contents of a site. This site has a 4 % match | |
Image alt tags | 0% | Image alt tags should to some degree reflect the contents of a site. This site has a 0 % match | |
Bold and italic | 39% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 13 % match | |
Html ratio | 40% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 50% | 50 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 20% | An ideal page contains between 400 and 600 words.This page contains 4507 words | |
Server response time | 30% | A slow server slows down a website. This server responds 251.37% slower the average | |
Gzip compression | 30% | This site does not use Gzip compression. Pages may not display as fast as they could | |
Keywords in Domainname | 30% | There are no important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 266 inline style declarations ( <a style="color:green">) with a size of 6509 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 100% | Perfect, detected not (i)frames on your webpagina | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (2) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 100% | Perfect, we did not detect too many blocking JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
en.wikipedia.org images and descriptions
8 images found at en.wikipedia.org Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
http://en.wikipedia.org/static/images/icons/wikipedia.png height: 50 width: 50 description: no alt description found |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-wordmark-en.svg height: height attribute not set width: width attribute not set description: wikipedia |
|
http://en.wikipedia.org/static/images/mobile/copyright/wikipedia-tagline-en.svg height: 13 width: 117 description: the free encyclopedia |
|
https://upload.wikimedia.org/wikipedia/commons/thumb/8/8b/syrian_reconciliation_flag.png/200px-syrian_reconciliation_flag.png height: 120 width: 200 description: no alt description found |
|
https://upload.wikimedia.org/wikipedia/en/thumb/9/96/symbol_category_class.svg/16px-symbol_category_class.svg.png height: 16 width: 16 description: no alt description found |
|
https://login.wikimedia.org/wiki/special:centralautologin/start?type=1x1 height: 1 width: 1 description: no alt description found |
|
http://en.wikipedia.org/static/images/footer/wikimedia-button.svg height: 29 width: 84 description: wikimedia foundation |
|
http://en.wikipedia.org/w/resources/assets/poweredby_mediawiki.svg height: 31 width: 88 description: powered by mediawiki |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!