www.kompas.tv website review
![](/include/images/menno/screenl1.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/screenl2.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/loader.gif)
![](/include/images/pixel.png)
![](/include/images/menno/highlight.png)
Improve your SEO :: free trial!
www.kompas.tv is 53% geoptimaliseerd!
SEO Keyword summary for www.kompas.tv/entertainment/514203/gitar-eross-sheila-on-7-laku-dilelang-rp125-juta-langsung-donasi-untuk-gaza
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be wib
Focus keyword
Short and long tail
Short Tail Keywords wib juni gitar |
long Tail Keywords (2 words) juni 2024 26 juni eross candra rumah pemilu rp125 juta |
long Tail Keywords (3 words) 26 juni 2024 sheila on 7 teki santuy eps tts teka teki link live streaming teka teki santuy point kode internasional |
www.kompas.tv On-Page SEO Scan
Descriptive Elements
The <head> element of a www.kompas.tv/entertainment/514203/gitar-eross-sheila-on-7-laku-dilelang-rp125-juta-langsung-donasi-untuk-gaza page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
gitar eross sheila laku dilelang juta langsung donasi untuk gaza
Meta description
Meta description legth
Meta description SEO
lelang dimulai pada sabtu juni dan ditutup hari minggu pukul wib
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wwwkompastv logo kompascom lestari gitarerosssheilaon lakudilelangrp jutalangsungdonasiuntukgaza kompas play ikuti kuisnya dapatkan hadiahnya ayo tantang pikiranmu dan perluas pengetahuanmu siap untuk menjawab panggilan sejarah ikutan sekarang temukan jawaban tekateki silang kuliner dari berbagai negara dunia truktangkibbmterbakarditolngawimunculbeberapakalisuaraledakan masihbutuhrekankoalisipdipnilaisohibulimanbelumtentumajudipilkadajakarta duetaniessohibulbakaldikawalsampaipendaftaranpkstutupcelahcawagubdaripartailain aniesberencanasilaturahmikeprabowosekjengerindrasilahkantidakadayanghalangi pdippeluangduetaniesahokdipilkadadkijakartasuperkecil persen prakiraancuacajabodetabekhariinirabu juni bmkgjakartahujanringansaatsiang bmkg wilayahdiindonesiainiberpotensihujandisertaipetirhingga juli ketuadpppdiperikopaksekjenhastomasihaktifbertugaspimpinrapatpilkada linklivestreamingperuvskanadadicopaamerica kickoffjam wib ppdbsdjakartatahap ditutuphariinisimakcarapilihsekolahdankuotanya
Mobile SEO www.kompas.tv/entertainment/514203/gitar-eross-sheila-on-7-laku-dilelang-rp125-juta-langsung-donasi-untuk-gaza
Mobile rendering
![](/include/images/menno/screenl1.png)
![](/include/images/menno/screenl2.png)
![](/include/images/menno/highlight.png)
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
![](/include/images/icons/loader.gif)
![](/include/images/icons/loader.gif)
Marketing / lead generation for www.kompas.tv/entertainment/514203/gitar-eross-sheila-on-7-laku-dilelang-rp125-juta-langsung-donasi-untuk-gaza
Social Media
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
![]() |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
![seo tip:](http://www.webcijfers.nl/include/images/icons/alert.png)
SERP Link
SERP Description
Domain Level SEO
Domain name
13 characters long
Domain name SEO Impact
Path name
eross found in path !
gitar found in path !
juta found in path !
lelang found in path !
sheila found in path !
untuk found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Favicon icon found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
HTML request without WWW redirected correctly?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Robots.txt found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Sitemap found?
![](http://www.webcijfers.nl/include/images/icons/loader.gif)
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
kompas tv
selengkapnya
lihat semua
|
editor deni muliya
|
ekonomi ekonomi dan bisnis
energi
keuangan
properti
perbankan
loker
|
entertainment selebriti
film
musik
seni budaya
komedi
datatitle
brian keluar adam ungkap dirinya duta dan eross masih bisa senangsenang dengan sheila on 7
tiba di mekkah raffi ahmad langsung tawaf dan ungkap kemudahan haji furoda
lihat semua komentar
momen virgoun minta maaf kepada 3 anaknya garagara kasus narkoba
setelah tersangka pemasok sabu ditangkap polisi bakal periksa seluruh kru band last child
|
internasional kompas dunia
|
kolom opini
opini kompasianer
|
kuis menangkan jutaan rupiah lewat kuis kompastv
|
legal.kompas.tv privacy
|
lifestyle tren
kesehatan
travel
kuliner
beauty and fashion
|
login |
nasional politik
hukum
peristiwa
humaniora
rumah pemilu
masih butuh rekan koalisi pdip nilai sohibul iman belum tentu maju di pilkada jakarta
politik
/517868/duet-anies-sohibul-bakal-dikawal-sampai-pendaftaran-pks-tutup-celah-cawagub-dari-partai-lain
duet aniessohibul bakal dikawal sampai pendaftaran pks tutup celah cawagub dari partai lain
rumah pemilu
anies berencana silaturahmi ke prabowo sekjen gerindra silahkan tidak ada yang halangi
pdip peluang duet aniesahok di pilkada dki jakarta super kecil 000001 persen
bmkg 32 wilayah di indonesia ini berpotensi hujan disertai petir hingga 1 juli 2024
peristiwa
ketua dpp pdip eriko pak sekjen hasto masih aktif bertugas pimpin rapat pilkada 2024
polda jabar absen di sidang perdana praperadilan pegi eks kabareskrim nilai bukan untuk ulur waktu
|
olahraga sepak bola
badminton
motogp
f1
sports
link live streaming peru vs kanada di copa america 2024 kickoff jam 0500 wib
sepak bola
link live streaming inggris vs slovenia dimulai sebentar lagi kickoff jam 0200 wib
link live streaming denmark vs serbia di euro 2024 main pukul 0200 wib
|
partner |
pendidikan ppdb sd jakarta tahap 2 ditutup hari ini simak cara pilih sekolah dan kuotanya
sekolah
|
penulis ade indra kusuma
|
regional jabodetabek
banten
jawa barat
jawa tengah diy
jawa timur
kalimantan
sulawesi
sumatra
bali nusa tenggara
papua maluku
berita daerah
prakiraan cuaca jabodetabek hari ini rabu 26 juni 2024 bmkg jakarta hujan ringan saat siang
jabodetabek
|
register |
saintek sains
teknologi
|
tag sheila on 7
hari bersamanya
lirik lagu sheila on 7
chord gitar sheila on 7
sheila on 7 live
|
talkshow rosi
satu meja
dua arah
lanturan
livi on point
kode
|
video vod
top 3 news
ni luh
opini budiman
60 special report
sinau
truk tangki bbm terbakar di tol ngawi muncul beberapa kali suara ledakan
vod
hacker minta tebusan 8 juta dolar as begini respons pemerintah indonesia
penertiban lapak pkl di jalur puncak bogor berujung ricuh pedagang blokade jalan
polda jabar mangkir dari sidang praperadilan malah periksa 2 terpidana kasus vina
surya paloh sebut orang capek hadapi anies baswedan dominasi survei rankingnya nomor 1
warga gelar doa bersama untuk pegi dan terpidana juga ketua rt pasren
geger dugaan pungli berujung tinggal kelas sman 8 medan ayah ada sentimen pribadi
polisi selidiki laporan ortu siswa soal dugaan pungli di sman 8 medan
temuan 94 calon siswa di bandung pakai kk palsu dalam proses pendaftaran ppdb
penasihat kapolri penyidik hatihati tangani kasus pembunuhan vina
respons kemenkeu soal anggaran makan bergizi mencapai rp 71 triliun
|
www.kompas.tv live tv
tv digital
our anchors
nasional
regional
video
talk show
pertamina talks
internasional
ekonomi
olahraga
entertainment
lifestyle
saintek
kolom
about us
cyber media guidelines
contact us
career
|
Links to external pages
Outloing links
www.kompas.com
www.kompasiana.com
www.tribunnews.com
www.kontan.co.id
www.bolasport.com
www.grid.id
www.gridoto.com
www.gramedia.com
www.kgmedia.id
www.esgpositiveimpactconsortium.asia
www.facebook.com
SEO Advice for www.kompas.tv
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 65% | A title should reflect the contents of a site. This site has a 50 % match | |
Title Length | 80% | Limit your title to anywhere between 40 and 70 characters. Your title was 77 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 60% | The meta description should be between 145 and 160 characters. This meta description is 94 characters long. | |
Meta description relevance | 81% | Meta Description should reflect the contents of a site. This site has a 45 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 214 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 19 level 1 folders and 51 folders above or in the first level of navigation. | |
Headings | 21% | Headers should reflect the contents of a site. This site has a 9 % match | |
Links | 18% | Link anchors should to some degree reflect the contents of a site. This site has a 9 % match | |
Image alt tags | 36% | Image alt tags should to some degree reflect the contents of a site. This site has a 13 % match | |
Bold and italic | 60% | Bold and italic tags should reflect the contents of a site to some degree. This site has a 20 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 75% | 75 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 60% | An ideal page contains between 400 and 600 words.This page contains 997 words | |
Server response time | 30% | A slow server slows down a website. This server responds 425.01% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 14% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 24 inline style declarations ( <a style="color:green">) with a size of 867 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 3 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (11) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (23) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.kompas.tv images and descriptions
11 images found at www.kompas.tv Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=ng4xp1iw1d10t3 height: 1 width: 1 description: no alt description found |
|
https://media.kompas.tv/frontend/img.png height: 124 width: 221 description: ppdb-sd-jakarta-tahap-2-ditutup-hari-ini-simak-cara-pilih-sekolah-dan-kuotanya |
|
https://media.kompas.tv/webassets/assets_v1/365x100web.png height: 68 width: 250 description: www.kompas.tv |
|
https://media.kompas.tv/webassets/assets_v1/kompastv.png height: 51px width: 180px description: www.kompas.tv |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_muter.gif height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_biruv2.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/lestari_putih.png height: height attribute not set width: width attribute not set description: logo kompascom lestari |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-pln.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-signify-v2.png height: height attribute not set width: width attribute not set description: no alt description found |
|
https://media-origin.kompas.tv/lestari/desktop/img/partner/logo-asia-sustainability-new.png height: height attribute not set width: width attribute not set description: no alt description found |
|
http://www.kompas.tv/ height: 22 width: 197 description: kompas tv play |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!