www.kompas.tv website review
Improve your SEO :: free trial!
www.kompas.tv is 55% geoptimaliseerd!
SEO Keyword summary for www.kompas.tv/video/vod
Keywords are extracted from the main content of your website and are the primary indicator of the words this page could rank for. By frequenty count we expect your focus keyword to be wib
Focus keyword
Short and long tail
Short Tail Keywords wib september vod |
long Tail Keywords (2 words) 27 september september 2024 wib vod 2219 wib 2024 2219 |
long Tail Keywords (3 words) 27 september 2024 2219 wib vod september 2024 2219 2024 2219 wib sidang pk terpidana perbankan loker olahraga keuangan properti perbankan |
www.kompas.tv On-Page SEO Scan
Descriptive Elements
The <head> element of a www.kompas.tv/video/vod page is used to inform the browser and visitors of the page about the general meta information. The head section of the page is where we place the page title, the definition of the HTML version used, the language of in which the page is written. In the head section we can also include JavaScript and CSS (markup) files for the page.
Page title
Title length
video demand berita kompastv terkini
Meta description
Meta description legth
Meta description SEO
vod berita kompastv terkini yang dapat diakses kapanpun manapun dengan cepat
Content SEO
Number of Words
Spam detected?
Headings
Heading distribution
Heading normalisation
Heading SEO impact
Emphasis (bold and italic)
Emphasis SEO impact
Images
Number of images
Images dimensions
Image alt descriptions
Images SEO impact
wwwkompastv hakimsidangpkterpidanadatangitkpvinaekyhinggapuansoalisugantigibrantop news fulljokowibukarakornasbaznasceritapembangunaniknhinggamintakembangkanprogramzakat hakimdatangitkpdicirebonsaksisebutlihatvinaekyjatuhtabraktiangdijembatan priaasallampungmengakuwartawanpakailencanapalsuperaskorbanjutaanrupiah perempuantewasterikatdalamlemariindekosdijambipolisiungkapdugaanpembunuhan pramonosoalvisimisianiesuntukpilgubjakartaesensinyasama bantahtuduhanpenggelembungansuaratiarahmaniainginnamabaiknyapulih penculikanaksdditangerangselatanditangkapmodusdengansebutorangtuakorbankecelakaan viralpolisidilampungtangkapbegalbersenjataapisambilbawaanakistridimobil fullupdate jenazahdikalibekasi diidentifikasiscientificinvestigationhinggaotopsi fullluluklukmankhofifahemildanrismagushansusaipengundiannomorurutpilgubjatim fullahlimatajelaskansoalbataspenglihatanmanusiadisidangpkterpidanavina bawasluselidikidugaanpelanggaranterkaitaksitebaruangdikampanyecagubjeje fullahlikecelakaanlalulintasbicarakasuslakajadipembunuhanhinggasinggungipturudiana dinilaijadipemicupenyakitwargatuntutkadestutuptpsilegal jenazahdikalibekasiberhasildiidentifikasipolisimasihtelusuripenyebabkematian fullkonpersmenkopolhukamhaditerkaitpembebasanpilotsusiairphilipmehrtensdarikkb detikdetikkaptenphilipmarkmerhtenstibadijakartausaidibebaskankkb fullpolitisigolkarungkapalasanprabowopecahkementerianpengamatfokusataubalasbudi oknumwartawanngakupolisiperaswargatemanggungmodusterserempetkendaraan
Mobile SEO www.kompas.tv/video/vod
Mobile rendering
Mobile optimizations
Responsive design detected (mobile css)
No flash detected !
Mobile improvement
Marketing / lead generation for www.kompas.tv/video/vod
Social Media
Facebook shares | Facebook likes | ||
Facebook comments | Tweets | ||
Google +1 |
Conversion form
Search form
Analytics
Online presence
SERP Preview
SERP Title
SERP Link
SERP Description
Domain Level SEO
Domain name
13 characters long
Domain name SEO Impact
Path name
video found in path !
vod found in path !
Structured data
Publisher Markup
Other Structured data
Website configuration
Correct processing of non-existing pages?
Favicon icon found?
HTML request without WWW redirected correctly?
Robots.txt found?
Sitemap found?
Navigation and internal links
Navigation
Url seperator
Human readable urls
Number of links
Link SEO Impact
lestari
|
ekonomi ekonomi dan bisnis
energi
keuangan
properti
perbankan
loker
|
entertainment selebriti
film
musik
seni budaya
komedi
|
foto berita foto
|
internasional kompas dunia
|
kolom opini
opini kompasianer
|
legal.kompas.tv privacy
|
lifestyle tren
kesehatan
travel
kuliner
beauty and fashion
|
login |
nasional politik
hukum
peristiwa
humaniora
rumah pemilu
|
olahraga sepak bola
badminton
motogp
f1
sports
|
regional jabodetabek
banten
jawa barat
jawa tengah diy
jawa timur
kalimantan
sulawesi
sumatra
bali nusa tenggara
papua maluku
berita daerah
|
register |
saintek sains
teknologi
|
talkshow rosi
satu meja
dua arah
lanturan
livi on poin
kode
|
video vod
top 3 news
ni luh
opini budiman
60 special report
sinau
bawaslu mengusut dugaan bagibagi uang saat kampanye jeje wiradinata di subang
khofifah ziarah ke makam gubernur m noer di sampang beliau adalah teladan
pelukan hingga selfie bareng saat ridwan kamil bertemu pramono anungrano karno
2 kader pdip gagal dilantik jadi anggota dpr dan dipecat partai ini penjelasannya
sudirman tunjukkan bekas luka tembak peluru karet di depan hakim saat sidang pk terpidana vina
hakim sidang pk terpidana datangi tkp vinaeky hingga puan soal isu ganti gibran top 3 news
vod
full jokowi buka rakornas baznas cerita pembangunan ikn hingga minta kembangkan program zakat
hakim datangi tkp di cirebon saksi sebut lihat vinaeky jatuh tabrak tiang di jembatan
pria asal lampung mengaku wartawan pakai lencana palsu peras korban jutaan rupiah
perempuan tewas terikat dalam lemari indekos di jambi polisi ungkap dugaan pembunuhan
pramono soal visi misi anies untuk pilgub jakarta esensinya sama
bantah tuduhan penggelembungan suara tia rahmania ingin nama baiknya pulih
penculik anak sd di tangerang selatan ditangkap modus dengan sebut orang tua korban kecelakaan
viral polisi di lampung tangkap begal bersenjata api sambil bawa anak istri di mobil
/541523/full-update-7-jenazah-di-kali-bekasi-4-diidentifikasi-scientific-investigation-hingga-otopsi
full update 7 jenazah di kali bekasi 4 diidentifikasi scientific investigation hingga otopsi
full luluklukman khofifahemil dan rismagus hans usai pengundian nomor urut pilgub jatim
full ahli mata jelaskan soal batas penglihatan manusia di sidang pk terpidana vina
bawaslu selidiki dugaan pelanggaran terkait aksi tebar uang di kampanye cagub jeje
full ahli kecelakaan lalu lintas bicara kasus laka jadi pembunuhan hingga singgung iptu rudiana
dinilai jadi pemicu penyakit warga tuntut kades tutup tps ilegal
7 jenazah di kali bekasi berhasil diidentifikasi polisi masih telusuri penyebab kematian
full konpers menko polhukam hadi terkait pembebasan pilot susi air philip mehrtens dari kkb
detikdetik kapten philip mark merhtens tiba di jakarta usai dibebaskan kkb
full politisi golkar ungkap alasan prabowo pecah kementerian pengamat fokus atau balas budi
oknum wartawan ngaku polisi peras warga temanggung modus terserempet kendaraan
|
www.kompas.tv live tv
tv digital
our anchors
nasional
regional
video
talks show
pertamina talks
internasional
ekonomi
olahraga
entertainment
lifestyle
saintek
kolom
fotonew
about us
cyber media guidelines
contact us
career
|
Links to external pages
Outloing links
www.kompas.com
www.kompasiana.com
www.tribunnews.com
www.kontan.co.id
www.bolasport.com
www.grid.id
www.gridoto.com
www.gramedia.com
www.kgmedia.id
www.facebook.com
SEO Advice for www.kompas.tv
In this section we provide pointers on how you can to optimize your web page so it can be found more easily by search engines and how to make it rank higher by optimizing the content of the page itself. For each of the individual criteria the maximum score is 100%. A score below 70% is considered to be indication that the page is not complying with general SEO standards and should be evaluated and/or fixed. Not every factor is weighted the same and some are not as important as others. Relatively unimportant factors like meta keywords are not included in the overall score.
Item | Factor | Pointers | |
---|---|---|---|
PageTitle | 100% | Far too many sites lack a page title. A page title is the first thing that shows in the search results so always use the title element. | |
Title relevance | 52% | A title should reflect the contents of a site. This site has a 40 % match | |
Title Length | 100% | Limit your title to anywhere between 40 and 70 characters. Your title was 52 characters long | |
Meta Description | 100% | A meta description is the second element that shows in the search results so always use the meta description. | |
Meta description length | 60% | The meta description should be between 145 and 160 characters. This meta description is 80 characters long. | |
Meta description relevance | 32% | Meta Description should reflect the contents of a site. This site has a 18 % match | |
Number of internal links | 30% | Linking to internal pages makes pages easier to find for search engines. Try to keep the number of links on your page roughly below 100. There are 222 internal links on this page. | |
Folder structure | 100% | We found a folder structure in the links on your page. A good folder structure makes a site easier to navigate. We found 14 level 1 folders and 43 folders above or in the first level of navigation. | |
Headings | 21% | Headers should reflect the contents of a site. This site has a 9 % match | |
Links | 22% | Link anchors should to some degree reflect the contents of a site. This site has a 11 % match | |
Image alt tags | 11% | Image alt tags should to some degree reflect the contents of a site. This site has a 4 % match | |
Html ratio | 30% | Try to keep the html / text ratio as low as possible. More html means longer loading times. Layout should be handled in a serpate css file | |
Image descriptions | 74% | 74.193548387097 % of all images have been described via the "alt" attribute. Describing images with relevant text may lead to better results in the search engines. | |
Page errors | 100% | Pages with no errors display significantly faster on most browsers. We detected 0 errors and warnings | |
WordCount | 90% | An ideal page contains between 400 and 600 words.This page contains 693 words | |
Server response time | 30% | A slow server slows down a website. This server responds 399.09% slower the average | |
Gzip Compression | 100% | This site uses Gzip compression to display faster | |
Keywords in Domainname | 100% | There are important keywords in your domain name | |
Keywords in domain path | 100% | There are important keywords in the domain path | |
Structured Data | 100% | Structured data makes it easier for search engines to index your website | |
Inline css | 0% | Do not use inline css declarations. Inline css will slow down the rendering of the website. We detected 29 inline style declarations ( <a style="color:green">) with a size of 997 bytes | |
Excessive use of the same words | 100% | There is no indication that there are one or more keywords that are used excessively. | |
Frames or iframes | 20% | The use of (i)frames can lead to problems crawling your page. Wij found 2 frame(s) on your page | |
Flash | 100% | Perfect, we detected no flash objects on your page | |
Css | 30% | We detected too much (7) CSS files on your page. Css files block the loading of a webpage. | |
Javascript | 30% | Wij detected too much (14) blocking JavaScript files. Try to combine or defer the loading of JavaScript files | |
Mobile Website | 100% | Perfect, we found a responsive design for mobile users | |
Most important heading | 100% | Perfect, we detected a correct use of the most important (h1) heading! | |
Normalized headings | 40% | We dit not font a normalized heading structure. A heading 2 (h2) for example should be followed by a heading of an equal level (h2), a child heading (h3) or even a aprent heading (h1). |
How would you like to have SEO advice for all your pages ?? Start your SEO Dashboard and optimize your website!
www.kompas.tv images and descriptions
9 images found at www.kompas.tv Images can improve the user experience for a website by making a pag visually appealing Images can also add extra keyword relevance to a webpage by using alt tags. Images can also slow down a website. If the width and height for a picture is not specified for a browser know in advance how large the image is. A browser must first load the picture and see before it knows how much space should be on the page. Upon reservation In the meantime, the browser can do little but wait. When the height and width for the plate are given in the HTML code, a browser just continues to build for a page while the images load in the background.
https://d5nxst8fruw4z.cloudfront.net/atrk.gif?account=ng4xp1iw1d10t3 height: 1 width: 1 description: no alt description found |
|
https://media.kompas.tv/frontend/img.png height: 124 width: 221 description: oknum-wartawan-ngaku-polisi-peras-warga-temanggung-modus-terserempet-kendaraan |
|
https://media.kompas.tv/webassets/assets_v1/365x100web.png height: 68 width: 250 description: www.kompas.tv |
|
https://media-origin.kompas.tv/frontend/desktop/images/kompastv.webp height: 51px width: 180px description: www.kompas.tv |
|
https://media-origin.kompas.tv/library/image/thumbnail/1727445280419/1727445280419.a_374_217.jpg height: height attribute not set width: 100% description: no alt description found |
|
https://media-origin.kompas.tv/library/image/thumbnail/1727447473615/1727447473615.a_374_217.jpg height: height attribute not set width: 100% description: no alt description found |
|
https://media-origin.kompas.tv/library/image/thumbnail/1727451305808/1727451305808.a_374_217.jpg height: height attribute not set width: 100% description: no alt description found |
|
https://media-origin.kompas.tv/library/image/thumbnail/1727447217217/1727447217217.a_374_217.jpg height: height attribute not set width: 100% description: no alt description found |
|
https://media-origin.kompas.tv/library/image/thumbnail/1727451055742/1727451055742.a_374_217.jpg height: height attribute not set width: 100% description: no alt description found |
How are images contributing to your SEO site-wise ? Your leading content tool has the awnsers!